KEGG   Rattus norvegicus (rat): 192675
Entry
192675            CDS       T01003                                 

Gene name
Bsnd
Definition
(RefSeq) barttin CLCNK type accessory beta subunit
  KO
K19331  barttin (chloride channel Ka/b beta subunit)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    192675 (Bsnd)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel (CLC)
   192675 (Bsnd)
SSDB
Motif
Pfam: Barttin Got1
Other DBs
NCBI-GeneID: 192675
NCBI-ProteinID: NP_620435
RGD: 621139
Ensembl: ENSRNOG00000006543
UniProt: Q8R2H3
Position
5q34
AA seq 308 aa
MADEKTFRIGFIVLGLFLLSLGTFLMSHDRPQVYGTFYAMGSIMVIGGVLWSMCQCYPKI
TFVPADSDFQGMLSPKALSLLETGLSEVKSPQPPYVRLWEEAAYDQSLPDFTHIQMKVMG
YSEDPRPLLAPELKTGTSSAKEGEPHSAQTWMEAAVVVHRELDEKEGEKSRSQSSPPACS
QGSAPLASFHDDLDVGSSEGRSPQPSPPDRDEAHLQVPWASRGPLDRFGDFALIDDTPIS
EDMGLEGQAQEEALPSKQPWSLRMKEETVQAGAEEPEQEEEDLYYGLPDSPGDPLPDKEL
GFEPDVQG
NT seq 927 nt   +upstreamnt  +downstreamnt
atggctgacgagaagaccttccgaatcggtttcatcgtgctgggccttttcctgctatcc
ctgggcacattccttatgagccacgatcgaccccaagtctacggcaccttctatgccatg
ggcagcatcatggtgattgggggtgtcctctggagcatgtgccaatgctatcctaagatc
acctttgtgccggcagactctgacttccaaggcatgttgtccccaaaggccctgagcctg
ctggagactgggctttcagaagtaaagagcccccagcccccctacgtcaggctgtgggaa
gaagccgcttatgaccagagcctcccagacttcactcacatccaaatgaaggtcatgggc
tacagtgaggaccccaggccactgctggcccccgaactgaagacaggaaccagcagtgcc
aaggaaggcgagcctcattctgctcagacctggatggaggctgcggtggtcgtccataga
gagttggatgagaaggagggagagaaatctcgttctcagagcagccctccagcgtgttcc
caaggctctgcacccttggcgtcatttcacgatgacttggacgtgggttctagcgaaggc
cgcagcccccagccatccccacctgacagagatgaggcacacctgcaggtgccctgggcc
agcagaggtccactggatcgcttcggtgactttgctctgattgatgacacccctatatca
gaggacatgggcctggaggggcaggcacaggaggaagctctacccagcaagcaaccatgg
tccctgaggatgaaggaggagactgtccaggcaggtgcagaagaaccagagcaggaggag
gaagatctgtactacgggctgcccgacagccctggggaccccctccctgacaaagagttg
ggctttgagcctgatgtccagggttga

DBGET integrated database retrieval system