KEGG   Rattus norvegicus (rat): 24153
Entry
24153             CDS       T01003                                 

Gene name
A2m
Definition
(RefSeq) alpha-2-macroglobulin precursor
  KO
K03910  alpha-2-macroglobulin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24153 (A2m)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24153 (A2m)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24153 (A2m)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24153 (A2m)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   24153 (A2m)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    24153 (A2m)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   24153 (A2m)
SSDB
Motif
Pfam: TED_complement A2M A2M_BRD A2M_recep MG3 MG4 MG2 SVA ADP_ribosyl_GH Big_1 MG1 MP
Other DBs
NCBI-GeneID: 24153
NCBI-ProteinID: NP_036620
RGD: 2004
Ensembl: ENSRNOG00000028896
UniProt: P06238
Position
4
AA seq 1472 aa
MGKHRLRSLALLPLLLRLLLLLLPTDASAPQKPIYMVMVPSLLHAGTPEKACFLFSHLNE
TVAVRVSLESVRGNQSLFTDLVVDKDLFHCTSFTVPQSSSDEVMFFTVQVKGATHEFRRR
STVLVKKKESLVFAQTDKPIYKPGQTVRFRVVSLDESFHPLNELIPLLYIQDPKNNRIAQ
WQNFNLEGGLKQLSFPLSSEPTQGSYKVVIRTESGRTVEHPFSVEEFVLPKFEVRVTVPE
TITILEEEMNVSVCGIYTYGKPVPGRVTVNICRKYSNPSNCFGEESVAFCEKLSQQLDGR
GCFSQLVKTKSFQLKRQEYEMQLDVHAKIQEEGTGVEETGKGLTKITRTITKLSFVNVDS
HFRQGIPFVGQVLLVDGRGTPIPYETIFIGADEANLYINTTTDKHGLARFSINTDDIMGT
SLTVRAKYKDSNACYGFRWLTEENVEAWHTAYAVFSPSRSFLHLESLPDKLRCDQTLEVQ
AHYILNGEAMQELKELVFYYLMMAKGGIVRAGTHVLPLKQGQMRGHFSILISMETDLAPV
ARLVLYAILPNGEVVGDTAKYEIENCLANKVDLVFRPNSGLPATRALLSVMASPQSLCGL
RAVDQSVLLMKPETELSASLIYDLLPVKDLTGFPQGADQREEDTNGCVKQNDTYINGILY
SPVQNTNEEDMYGFLKDMGLKVFTNSNIRKPKVCERLRDNKGIPAAYHLVSQSHMDAFLE
SSESPTETRRSYFPETWIWDLVVVDSAGVAEVEVTVPDTITEWKAGAFCLSNDTGLGLSP
VVQFQAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPTCIRVAVQLEASPDFLAAPEEKE
QRSHCICMNQRHTASWAVIPKSLGNVNFTVSAEALNSKELCGNEVPVVPEQGKKDTIIKS
LLVEPEGLENEVTFNSLLCPMGAEVSELIALKLPSDVVEESARASVTVLGDILGSAMQNT
QDLLKMPYGCGEQNMVLFAPNIYVLDYLNETQQLTQEIKTKAIAYLNTGYQRQLNYKHRD
GSYSTFGDKPGRNHANTWLTAFVLKSFAQARKYIFIDEVHITQALLWLSQQQKDNGCFRS
SGSLLNNAMKGGVEDEVTLSAYITIALLEMSLPVTHPVVRNALFCLDTAWKSARGGAGGS
HVYTKALLAYAFALAGNQDTKKEILKSLDEEAVKEEDSVHWTRPQKPSVSVALWYQPQAP
SAEVEMTAYVLLAYLTTEPAPTQEDLTAAMLIVKWLTKQQNSHGGFSSTQDTVVALHALS
KYGSATFTRAKKAAQVTIHSSGTFSTKFQVNNNNQLLLQRVTLPTVPGDYTVKVTGEGCV
YLQTSLKYSVLPREEEFPFTVVVQTLPGTCEDPKAHTSFQISLNISYTGSRSESNMAIAD
VKMVSGFIPLKPTVKMLERSVHVSRTEVSNNHVLIYLDKVSNQTVNLSFTVQQDIPIRDL
KPAVVKVYDYYEKDEFAVAKYSAPCSTDYGNA
NT seq 4419 nt   +upstreamnt  +downstreamnt
atggggaagcacaggctccggagcctggccctgctgccactgctgctgcggctgctgctg
ctgctgctgcccaccgatgcctcagctccacaaaaaccaatctacatggtgatggttccc
tccctgctccacgcaggcacccccgagaaggcctgcttcctgttcagccatctaaacgag
acagtggctgtgagagtgtccttggagtctgtccgtgggaaccaaagcctcttcactgac
cttgtagttgacaaggacctattccactgtacctccttcaccgtcccacagtcttcatcc
gatgaggtgatgtttttcactgtccaagtaaaaggagcaactcatgagttcaggaggcgg
agcacggtgctggttaagaagaaagagagcctggtctttgctcagactgacaagcccatc
tacaaaccaggacagacagtgagatttcgtgttgtctcattggacgaaagtttccatccc
cttaatgaattgattcctctactgtacattcaggatcccaaaaacaatcgcattgcacaa
tggcagaatttcaatttagagggtggcctcaaacagctgtccttccccctctcctcagag
cccactcagggctcctacaaggtggtgatacgtacagaatcaggcaggaccgtcgagcac
cctttctctgtggaggaattcgtgcttcccaagttcgaagtgagagtgacagttccagaa
acaatcaccatcctggaggaagagatgaatgtgtccgtgtgtggaatatacacctatggg
aagcctgttccaggacgtgtgactgtaaacatttgcagaaagtacagtaatccttctaac
tgcttcggcgaagagtccgtggctttctgtgagaaactcagccaacagttagacggccgt
ggctgcttctcacagctagtgaaaaccaagtccttccagctaaagagacaagagtatgag
atgcagctcgatgtacatgccaagatccaagaagaaggaacaggtgtggaagaaactgga
aaggggctcactaagatcacaagaaccataaccaaactatcatttgtgaacgtggattca
catttcagacaaggaattcctttcgttggacaggtgctcctggtggatgggagaggcacc
cctattccgtatgaaacgatcttcattggggcggatgaagcaaacctgtacataaataca
accactgataagcacggcctggcgaggttctccatcaacaccgatgacatcatgggcacg
tccctaactgtcagggccaaatacaaggatagcaacgcctgctatggattcagatggttg
acagaagagaatgtagaggcttggcacactgcctacgctgttttctcaccaagcagaagc
ttcctgcacctggaatccctgcctgataaactgcgctgtgaccaaaccctggaggtccag
gcacattacattctaaatggcgaggccatgcaggagctgaaggagctcgtcttctactat
ctgatgatggccaagggaggcatcgtacgggcggggactcacgttctgcccctgaagcag
ggacaaatgagaggtcacttttccatactcatctcgatggagacagacctggctcccgtg
gctcgactggtcctctatgccatcctacccaatggagaagtggttggagacactgctaaa
tatgagattgagaactgcctggctaacaaggtggatttggtcttccgcccgaatagcggt
cttccagctacccgtgccctccttagtgtcatggcttctcctcagtccctttgtggcctg
cgagctgtggaccaaagcgtgctgctcatgaaacctgagactgagctctccgcatccctg
atttatgacctgctaccagtgaaagacctcactggcttccctcagggtgcggatcaacgg
gaagaagacactaatggctgcgttaagcaaaatgacacttacattaatggaatcctgtac
tcgccagtgcagaatacaaatgaagaggacatgtacggcttcctaaaggatatgggctta
aaggtatttaccaactcgaacatccgtaaacccaaagtctgcgaacggctcagagacaat
aaaggaataccagctgcgtaccacctcgtaagccaaagccacatggacgcttttctagag
tcttcagagtctcccacagagactaggcgaagctacttccctgagacgtggatctgggac
ttggtggtggtggactcagcaggagtggctgaagtggaagtgacagtccctgacaccatc
actgaatggaaggccggggccttctgcctgtctaatgacactggtctgggcctgtctcct
gtggtccaattccaagccttccagcccttcttcgtggagctcacaatgccctactccgtg
atccgtggagaagccttcacgctcaaggccactgtgctgaactacctccctacatgcatc
cgggttgccgtgcagctggaggcctctcccgattttctggctgccccagaggagaaggaa
caaaggtctcactgcatctgtatgaaccagcggcacaccgcgtcctgggcagtgatcccc
aagtcattaggaaatgtgaatttcacagttagtgcagaggcactgaactctaaggagctg
tgtgggaatgaggtaccggtggtccctgaacagggcaaaaaagacacgatcatcaagtcc
ctgctggttgaacccgaaggtctagagaacgaagtgacatttaacagtctgctttgtcca
atgggtgctgaggtatctgaactgatagccctgaagctgccatcagacgtggtagaggaa
tctgccagagcctctgtcacagttttgggagatatattgggttctgccatgcagaataca
caggatctcctcaagatgccctatggctgtggagaacagaacatggttctatttgctcct
aatatctatgtcctggactatctgaatgaaacacagcagctgacacaggagatcaagacc
aaggccattgcctatctcaatacgggctaccaaagacaattaaactacaagcaccgggat
ggctcctacagcacctttggggataaacctggcaggaatcatgccaatacctggctcaca
gcctttgtactgaagagttttgctcaggctcgaaaatatatcttcatcgatgaagtacac
atcacccaagccctcttatggctctctcagcagcagaaggacaatggttgtttcaggagc
tccgggtcactgctcaacaatgccatgaagggaggagtagaagatgaagtcaccttgtct
gcctacatcaccatagctctcctggagatgtctcttcctgtcactcatcctgttgtccgc
aatgccctcttttgcctggacacagcctggaagtcagcaaggggaggagctggtggcagc
catgtctacactaaggcgctgttggcctatgcatttgcccttgctggtaaccaggacacg
aagaaggagatcctgaaatcactcgatgaggaggctgtaaaagaagaagattctgtccac
tggaccagacctcagaaacccagcgtgtcagtggccctctggtaccaaccccaggctccc
tcggctgaggtagagatgactgcatatgtgctcctggcttatcttaccactgagccagct
ccaacccaagaggacctaacggctgccatgctcatcgtgaagtggctcacaaagcagcag
aattcccacggtggcttctcttccacccaggacactgtagtggctctccacgctttgtcc
aaatacgggtccgccactttcacaagagctaagaaagctgcacaggtgaccatccattct
tcgggcacattttctacaaaattccaagtcaacaacaacaaccaattattactccagaga
gtcacattgccgactgtgcctggggattacaccgtgaaggtgacaggagaaggctgtgtc
tatctccagacatccttgaaatacagtgttctcccgagagaggaggagttccccttcact
gtggtggtgcagactctgcctgggacatgtgaggatcccaaagctcacaccagcttccag
atctcactcaacatcagttacactggaagccgttctgaatccaacatggcaattgctgac
gtgaagatggtgtccggcttcatccccttgaaaccaacagtgaaaatgcttgaaagatct
gtgcatgtgagccgaacagaagtcagcaataaccatgtcttgatttacctggataaggtg
tcaaatcagacggtgaacttgtccttcacggttcagcaagatattccaataagagacctg
aagccagccgtagtgaaagtctacgattactatgagaaagatgagtttgcagttgcaaaa
tacagcgctccctgcagcacagattatggaaatgcctga

DBGET integrated database retrieval system