KEGG   Rattus norvegicus (rat): 24215
Entry
24215             CDS       T01003                                 

Gene name
Atp2b2
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04925  Aldosterone synthesis and secretion
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24215 (Atp2b2)
   04024 cAMP signaling pathway
    24215 (Atp2b2)
   04022 cGMP-PKG signaling pathway
    24215 (Atp2b2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    24215 (Atp2b2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24215 (Atp2b2)
  09154 Digestive system
   04970 Salivary secretion
    24215 (Atp2b2)
   04972 Pancreatic secretion
    24215 (Atp2b2)
   04978 Mineral absorption
    24215 (Atp2b2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    24215 (Atp2b2)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     24215 (Atp2b2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 24215
NCBI-ProteinID: NP_036640
RGD: 2176
Ensembl: ENSRNOG00000030269
UniProt: P11506
Position
4
AA seq 1198 aa
MGDMTNSDFYSKNQRNESSHGGEFGCSMEELRSLMELRGTEAVVKIKETYGDTESICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMS
AITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTI
SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIP
DPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLRQDYE
PVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDESFRMYSKGASEIVLKKCCKILSGAGEP
RVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGI
EDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRR
IRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDG
PALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTV
NVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKP
LISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMM
QLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWM
WCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRR
GQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLI
DDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3597 nt   +upstreamnt  +downstreamnt
atgggtgatatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcagcatggaggagctgcgctccctcatggagctgcggggcact
gaggctgtggtcaagatcaaggagacatatggggacactgaatccatctgccggcgcctc
aaaacctctcctgttgaaggtttgccaggcaccgctccagacctggaaaagaggaaacag
attttcgggcaaaacttcatacctccaaagaaaccaaaaaccttcctgcagctggtgtgg
gaagcactacaggacgtgacgctcatcatcctggagatcgcggccatcatctccctggga
ctgtccttctaccacccacccggagagagcaatgaaggatgtgccacggcccaaggtggg
gcagaagatgaaggtgaagcagaagcaggctggatcgagggggctgccatcctgctgtca
gtcatctgtgtggtcctcgtcacagccttcaatgattggagtaaagagaaacagttccgg
ggcctgcagagccgaattgagcaggaacagaagttcaccgtagtccgggctggccaggtg
gtccagatccctgtggccgagattgtggttggggacattgcccagatcaaatacggtgac
ctccttcctgctgatggcctcttcatccagggcaatgacctcaagatcgatgaaagctcg
ctcacaggggagtctgaccaggtgcgcaagtctgtggataaggaccctatgttgctgtca
ggaactcatgtgatggaaggctcaggacggatggtggtgactgctgtgggtgtcaactct
caaactggcatcatatttaccctgcttggggctggtggtgaagaggaagagaagaaagac
aaaaaagccaagcagcaggatggggcagctgctatggaaatgcagcctctgaagagtgcg
gagggcggtgatgcagatgacaagaagaaagccaacatgcacaagaaagagaagtcggtg
cttcagggcaagctcaccaagctggctgtgcagataggcaaggcgggcctggtgatgtcg
gccatcacggtgatcatcctggtgctctacttcaccgtggacaccttcgtggtcaacaag
aagccgtggctgacggagtgcacaccggtctacgtgcagtacttcgtcaagttcttcatc
attggtgtgacggtgctggtggtcgctgtgcccgagggcctccctctggctgtcaccatc
tcactggcctattccgtgaagaaaatgatgaaggacaacaacctggtccgtcacctggac
gcctgtgagaccatgggtaacgccacagccatctgctcagacaagacaggcacgctgacc
accaaccgcatgaccgtggtgcaggcctatgtcggtgatgtccactacaaggagatccct
gatcccagctccatcaatgccaagacattggagctgctggtcaacgccattgccatcaac
agcgcctacaccaccaagatcctccccccagaaaaagagggcgccctgccccggcaggtg
ggcaacaagacagagtgtggcctgctgggcttcgtgctggacctgaggcaggattacgag
ccggtacgcagccagatgccagaggaaaagctgtataaggtgtacaccttcaactctgtg
cgcaagtccatgagcaccgtcatcaagatgcctgacgagagcttccgcatgtacagcaaa
ggtgcttcggagattgtgctcaaaaagtgctgcaagattctcagtggggcaggggagccc
cgtgtcttccggccccgtgacagggatgagatggttaagaaggtgatcgagcccatggcc
tgtgacgggctccgtaccatctgtgtggcctatcgtgacttccccagcagccctgagcct
gactgggacaatgagaatgacattctcaatgaactcacctgcatctgcgtggtgggcatc
gaagacccagtgcgacctgaggtcccagaagccatccgcaagtgccagcgggccggtatc
acagtccgcatggtcaccggtgacaacatcaacacagcccgggccatcgccatcaagtgt
ggcattatccaccctggagaggacttcctgtgcctggaaggcaaagaattcaatcggagg
atccgcaacgagaagggggagattgagcaggagcggattgacaagatctggccaaagctg
agggtgctggctcgatcctcgcccacggataagcacaccctggtcaaaggcatcatcgac
agcacacacactgagcagcggcaggtggtggctgtgacaggggatgggaccaacgatggg
cctgctctcaagaaggcagatgtgggcttcgcgatgggcatcgcaggcacggatgtggcc
aaggaggcctcagacatcatcctgacagacgacaacttcagcagcatcgttaaggcagtg
atgtggggccgtaatgtctatgacagcatatccaaattcctgcagtttcagctgactgtc
aatgtggtggctgtgatcgtggccttcacgggtgcctgcattacacaggactcccctctc
aaggcggtgcagatgctctgggtgaacctcatcatggacacatttgcttccctggccctg
gcaacagagccacccaccgagactctgctcctgaggaaaccttacggccgcaacaagccg
ctcatctcgagaaccatgatgaagaacatcctgggccacgccgtctaccagctaaccctc
atcttcaccctgctcttcgtgggtgagaagatgttccagattgacagcggaaggaacgcc
ccgctgcactcgccaccctcggagcactacaccatcatcttcaacaccttcgtcatgatg
cagcttttcaacgagatcaacgcccgtaagatccacggcgagcgtaacgtcttcgacgga
atcttccggaaccccatcttctgcaccatcgttctcggcacttttgccatccagatagtg
attgtgcagttcggcggcaaacccttcagctgctccccactccagctggaccagtggatg
tggtgcatcttcataggcctgggagagctcgtctggggccaggtcattgccaccatccct
accagcaggctcaagtttctgaaagaggcagggcggctaacacagaaggaggagatcccc
gaggaagagttaaatgaggatgtggaagagatagaccacgcagagcgggagcttcgccga
ggccagatcctatggttccggggcctgaatcggatccagacacagatccgcgtcgtgaag
gcgttccgtagctctctctatgaagggttagaaaaacccgagtctcgaacctccatccat
aacttcatggctcatcctgaattccggatcgaagattcccagccccacatccccctcatc
gatgacaccgacctggaagaagatgccgcgctcaagcagaactcgagcccgccgtcctcg
ctcaacaagaacaatagcgccatcgacagcgggatcaacctgacgaccgacacgagcaaa
tcagctacctcttcaagtccagggagccccatccacagcctggagacgtcgctttag

DBGET integrated database retrieval system