KEGG   Rattus norvegicus (rat): 24232
Entry
24232             CDS       T01003                                 

Gene name
C3
Definition
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04145  Phagosome
rno04610  Complement and coagulation cascades
rno05133  Pertussis
rno05134  Legionellosis
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24232 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24232 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24232 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    24232 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24232 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24232 (C3)
   05134 Legionellosis
    24232 (C3)
   05150 Staphylococcus aureus infection
    24232 (C3)
   05152 Tuberculosis
    24232 (C3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    24232 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24232 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    24232 (C3)
   05142 Chagas disease
    24232 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24232 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24232 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24232 (C3)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   24232 (C3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    24232 (C3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   24232 (C3)
SSDB
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD MG4 NTR MG1 MG3 MG2 ANATO
Other DBs
NCBI-GeneID: 24232
NCBI-ProteinID: NP_058690
RGD: 2232
Ensembl: ENSRNOG00000046834
UniProt: P01026 M0RBF1
Structure
PDB: 
1QQF 1QSJ

Position
9q12
AA seq 1663 aa
MGPTSGSQLLVLLLLLASSLLALGSPMYSIITPNVLRLESEETFILEAHDAQGDVPVTVT
VQDFLKKQVLTSEKTVLTGATGHLNRVSIKIPASKEFNADKGHKYVTVVANFGATVVEKA
VLVSFQSGYLFIQTDKTIYTPGSTVFYRIFTVDNNLLPVGKTVVIVIETPDGVPIKRDIL
SSHNQYGILPLSWNIPELVNMGQWKIRAFYEHAPKQTFSAEFEVKEYVLPSFEVLVEPTE
KFYYIDDPKGLEVSITARFLYGKNVDGTAFVIFGVQDEDKKISLAQSLTRVLIEDGSGEA
VLSRKVLMDGVRPSSPEALVGKSLYVSVTVILHSGSDMVEAERSGIPIVTSPYQIHFTKT
PKFFKPAMPFDLMVFVTNPDGSPARRVPVVTQGSDAQALTQDDGVAKLSVNTPNNRQPLT
ITVRTKKEGIPDARQATRTMQAQPYSTMHNSNNYLHLSVSRVELKPGDNLNVNFHLRTDA
GQEAKIRYYTYLVMNKGKLLKAGRQVREPGQDLVVLSLPITPEFIPSFRLVAYYTLIGAN
GQREVVADSVWVDVKDSCVGTLVVKGDPRDNRQPAPGHQTTLRIEGNQGARVGLVAVDKG
VFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKNYAGVFMDAGLTFKTNQGLQTDQREDPE
CAKPAARRRRSVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMKYSCQRRARLITQGESC
LKAFMDCCNYITKLREQHRRDHVLGLARSDVDEDIIPEEDIISRSHFPESWLWTIEELKE
PEKNGISTKVMNIFLKDSITTWEILAVSLSDKKGICVADPYEITVMQDFFIDLRLPYSVV
RNEQVEIRAVLFNYREQEKLKVRVELLHNPAFCSMATAKKRYYQTIEIPPKSSVAVPYVI
VPLKIGLQEVEVKAAVFNHFISDGVKKILKVVPEGMRVNKTVAVRTLDPEHLGQGGVQRE
DVPAADLSDQVPDTDSETRILLQGTPVAQMAEDAVDGERLKHLIVTPSGCGEQNMIGMTP
TVIAVHYLDQTEQWEKFGLEKRQEALELIKKGYTQQLAFKQPSSAYAAFNNRPPSTWLTA
YVVKVFSLAANLIAIDSQVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNTKEAD
VSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYLEASYLNLQRPYTVAIAGYALALMN
KLEEPYLTKFLNTAKDRNRWEEPGQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQTDVPDHKDLNMDVSLHLPSRSSPTVFRLLWESGSLLR
SEETKQNEGFSLTAKGKGQGTLSVVTVYHAKVKGKATCKKFDLRVTIKPAPETAKKPQDA
KSSMILDICTRYLGDVDATMSILDISMMTGFIPDTNDLELLSSGVDRYISKYEMDKAFSN
KNTLIIYLEKISHSEEDCLSFKVHQFFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDG
MLSKLCHNEMCRCAEENCFMHQSQDQVSLNERLDKACEPGVDYVYKTKLTTIELSDDFDE
YIMTIEQVIKSGSDEVQAGQERRFISHVKCRNALKLQKGKQYLMWGLSSDLWGEKPNTSY
IIGKDTWVEHWPEAEECQDQKNQKQCEDLGAFTETMVVFGCPN
NT seq 4992 nt   +upstreamnt  +downstreamnt
atgggacccacgtcagggtcccagctactagtgctactgctgctgttggccagctccctg
ctagctctggggagccccatgtactccatcattactcccaatgtcctgcggctggagagt
gaagagactttcatactagaggcccatgatgctcagggtgatgtcccagtcactgtcact
gtgcaagacttcctaaagaagcaagtgctgaccagtgagaagacagtgttgacaggagcc
actggacatctgaacagggtctccatcaagattccagccagtaaggaattcaatgcagat
aaggggcacaagtacgtgacagtggtggcaaacttcggggcaacagtggtggagaaagcg
gtgctagtaagctttcagagtggttacctcttcatccagacagacaagaccatctacacc
ccaggctccactgttttctatcggatcttcactgtggacaacaacctattgcctgtgggc
aagacagtcgtcatcgtcattgagaccccggacggcgttcccatcaagagagacattcta
tcttcccacaaccaatatggcatcttgcctttgtcttggaacattccagaactggtcaac
atggggcagtggaagatccgagccttctatgaacatgcaccaaagcagaccttctctgca
gagtttgaggtgaaggaatacgtgctgcccagtttcgaagtcctggtggagcctacagag
aaattttattacatcgatgacccaaagggcctggaagtttccatcacagccagattcctg
tatgggaagaacgtggacgggacagctttcgtgatctttggggtccaggatgaggataag
aagatttctctggcccagtccctcacccgcgtgctgatcgaggatggttcaggggaggca
gtgctcagccgaaaagtgctgatggacggggtacggccctccagcccagaagccctagtg
gggaagtccctgtacgtctctgtcactgttatcctgcactcaggtagcgacatggtagag
gcagagcgcagtgggatcccaattgtcacttccccgtaccagatccacttcaccaagaca
cccaaattcttcaagccagccatgcctttcgacctcatggtgtttgtgaccaaccctgat
ggctctccagcccgcagagtgccagtagtcactcagggatccgacgcgcaggctctcacc
caggatgatggtgtggccaagctgagcgtcaacacacccaacaaccgccaacccctgact
atcacggtccgcaccaagaaggagggtatcccggacgcgcggcaggccaccaggacgatg
caggcccagccctacagcactatgcacaattccaacaactacctgcacttgtcagtgtct
cgggtggagctcaagcctggggacaacctcaatgtcaacttccacctgcgcacggacgct
ggccaagaggccaagatccgatactacacctatctggttatgaacaaggggaagttactg
aaggcaggccgtcaggttcgggagcctggccaggacctggtggtcttgtcactgcccatc
actccagaatttataccttccttccgcctggtggcttactacaccctgattggagctaat
ggccaaagggaggtggtggccgactcagtgtgggtggatgtgaaggactcctgtgtaggc
acgctggtggtgaaaggtgacccaagagataaccgacagcccgcgcctgggcatcaaacg
acactaaggatcgaggggaaccagggggcccgagtggggctagtggctgtggacaagggg
gtgtttgtgctgaacaagaagaacaaactcacacagagcaagatctgggatgtagtagag
aaggcagacattggctgcaccccaggcagtgggaagaactatgcgggtgtcttcatggat
gctggcctgaccttcaagacaaaccaaggcctgcagactgatcagagagaagatcctgag
tgcgccaagccagctgcccgccgccgtcgctcagtgcagttgatggaaaggaggatggac
aaagctggtcagtacaccgacaagggtctgcggaagtgttgtgaggatggcatgcgtgat
atccctatgaagtacagctgccagcgccgggctcgcctcatcacccagggcgagagctgc
ctgaaggccttcatggactgctgcaactatatcaccaagcttcgtgagcagcacagaaga
gaccatgtgctgggcctggccaggagtgatgtggatgaagacataatcccagaagaagat
attatctctagaagccacttcccagagagctggttgtggaccatagaagagttgaaagaa
ccagagaaaaatggaatctctacgaaggtcatgaacatctttctcaaagattccatcacc
acctgggagattctggcagtgagcttgtccgacaagaaagggatctgtgtggcagacccc
tatgagatcacagtgatgcaggacttcttcattgacctgcgactgccctactctgtggtg
cgcaatgaacaggtggagatcagagctgtgctcttcaattaccgtgaacaggagaaactt
aaggtaagggtggaactgttgcataacccagccttctgcagcatggccactgccaagaag
cggtactaccagaccatcgaaatccctcccaagtcctctgtggctgtgccttatgtcatt
gtccccttgaagatcggcctccaggaggtggaggtcaaggccgccgtcttcaaccacttc
atcagtgatggtgtcaagaagatactgaaggtcgtgccagaaggaatgagagtcaacaaa
actgtggctgtccgtacactggatccagaacacctcggtcaagggggagtgcagagggag
gatgtacctgcagcagacctcagtgaccaagtgccagacacagattctgagaccagaatt
ctcctgcaagggaccccggtggctcagatggccgaggacgctgtggacggggagcggctg
aaacacctgatcgtgaccccctctggctgtggggagcagaacatgattggcatgacaccc
acggtcattgcagtacactatctggatcagaccgaacagtgggagaaattcggcctagag
aagaggcaagaagctctggagctcatcaagaaagggtacacccagcagctggctttcaaa
cagcccagctctgcctatgctgccttcaacaaccggcctcccagcacctggctgacagcc
tatgtggtcaaggtcttctctctggctgccaacctcatcgccatcgactctcaggtcctg
tgtggggctgtcaaatggctgattctggagaaacagaagccagatggtgtctttcaggag
gacggaccagtgattcaccaagaaatgattggtggcttccggaacaccaaggaggcagat
gtgtcgcttacagcctttgtcctcatcgcactgcaggaagccagagatatctgtgagggg
caggtcaacagccttcccgggagcatcaacaaggcaggggagtatcttgaagccagttac
ctgaacctgcagagaccatacacagtagccattgctgggtatgccctggccctgatgaac
aaactggaggaaccttacctcaccaagtttctgaacacagccaaagatcggaaccgctgg
gaggagcctggccagcagctctacaatgtggaggccacctcctacgccctcctggccctg
ctgctgctgaaagactttgactctgtgcctcctgtggtgcgctggctcaacgagcaaaga
tactacggaggtggctatggctccacgcaggctaccttcatggtattccaagccttggct
caataccaaacagatgtccctgaccacaaggacttgaacatggatgtgtccctccacctc
cccagccgcagctccccaactgtgtttcgcctgctatgggaaagtggcagtctcctgaga
tcagaagagaccaagcagaatgagggcttttctctgacagccaaaggaaaaggccaaggc
acactgtcggtggtgacagtgtatcacgccaaagtcaaaggcaaagccacctgcaagaag
tttgacctcagggtcaccataaaaccagcccctgagacagccaagaagccccaggatgcc
aagagttctatgatccttgacatctgcaccaggtacttgggagacgtggatgctactatg
tccatcctggacatctccatgatgactggctttattccagacacaaacgacctggaactg
ctgagctctggagtagacagatacatttccaagtatgagatggacaaagccttctccaac
aagaacaccctcatcatctacctagaaaagatctcacactccgaagaagactgcctgtcc
ttcaaagtccaccagttctttaacgtgggacttatccagccggggtcggtcaaggtctac
tcctactacaatctagaggagtcatgcacccggttctatcatccggagaaggacgatgga
atgctgagcaagctgtgccacaatgaaatgtgccgctgtgcagaggagaactgcttcatg
catcagtcacaggatcaggtcagcctgaatgaacgactagacaaggcttgtgagcctgga
gtggactacgtgtacaagaccaagctaacgacgatagagctgtcggatgattttgatgag
tacatcatgaccatcgagcaggtcatcaagtcaggctcagatgaggtgcaggcaggtcag
gaacgaaggttcatcagccacgtcaagtgcagaaacgccctaaagctgcagaaagggaag
cagtacctcatgtggggcctctcctccgacctctggggagaaaagcccaataccagctac
atcattgggaaggacacgtgggtggagcactggcccgaggcagaggaatgtcaggatcag
aagaaccagaaacagtgcgaagacctcggggcattcacagaaacaatggtggttttcggc
tgccccaactga

DBGET integrated database retrieval system