KEGG   Rattus norvegicus (rat): 24233Help
Entry
24233             CDS       T01003                                 

Gene name
C4a, C4, C4-1, C4b
Definition
(RefSeq) complement component 4A (Rodgers blood group)
  KO
K03989  complement component 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24233 (C4a)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24233 (C4a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24233 (C4a)
   05150 Staphylococcus aureus infection
    24233 (C4a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24233 (C4a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24233 (C4a)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   24233 (C4a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   24233 (C4a)
  Exosomal proteins of other cancer cells
   24233 (C4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD NTR MG2 MG3 ANATO MG4
Motif
Other DBs
NCBI-GeneID: 24233
NCBI-ProteinID: NP_113692
RGD: 620005
Ensembl: ENSRNOG00000047657
Vega: OTTRNOG00000001255
UniProt: P08649 Q6MG79
Position
20p12
AA seq 1737 aa AA seqDB search
MRLLWGLAWAFSFFASSLQKPRLLLFSPSVVNLGTPLSVGVQLLDAPAGQEVKGSVYLRN
PTSGPCSPKKDFKLSSGNDFVLLRLEVPLKDVRSCGLFGLRRAPHIQLVAHSPWLKNTAS
KATETQGVNLLFSSRRGHIFVQTDQPIYNPGQRVRYRVFALDQKMRPSTDTLTVTVENSH
GLRVRKKEVFAPTSIFQDDFIIPDISEPGTWKISARFSDGLESNRSTHFEVKKYVLPNFE
VKLTPWKPYILTVPSYREEIQLDVQARYVYGKPVQGVAYTRFALMDEQGKKSFLRGLETQ
TKLVEGQTHISISRDQFQAALGKVNTEIGDLEGLRLYAAVAVIESPGGEMEEAELTSWPF
VSSAFSLDLSHTKQHLVPGAPFLLQALVREMSGSEASDVPVKVSATLLSGSDSKVLDFQQ
NTNGIGQVSFSIHVPPTITELRLLVSAGSLYPAVAKLTVQAPPSRGPGFLSIEPLDLRSP
RVGDTFVLSLRTVGIPMPTFSHYYYMIISRGQIMAMSREPRRALTSISVLVDHHLAPSFY
FVAYFYHQGLPVANSLLINVQPGDCEGKLELKVDGAKEYRNGDSMKLQLQTDSEALVALG
AVDTALYAVGGRSHKPLDMSKVFEVMNSYNLGCGPGGGDDALQVFQTAGLAFSDGDRLTQ
TKENLSCPKEKKSRQKRNVNFQKAISEKLGQYSSPDTKRCCQDGMTKLPMARTCEQRAAR
VPQPACREPFLSCCKFAEDLRRNQTRSQAGLARAQDMLQEEDLIDEDDILVRSFFPENWL
WRVEPVDRSKLLTVWLPDSLTTWEIHGVSLSKSKGLCVAKPTRVRVFREFHLHLRLPISV
RRFEQLELRPVLYNYLSEDVTVSVHVSPVEGLCLAGGGLLAQQVSVPAGSARPVAFSVVP
TAAASIPLKVVARGSFTIGDAVSKILQIEKEGAIHREEIVYNLDPLNNLGRSLEIPGSSD
PNVIPDGDFSSFVRVTASEPLETLGSEGALSPGGVASLLRLPRGCAEQTMIYLAPTLTAS
HYLDRTEQWSKLPPETKDHAVDLIQKGHMRIQQFRKKDGSFGAWLHRDSSTWLTAFVLKI
LSLAQEQIGDSPEKLQETAGWLLGQQLDDGSFHDPCPVIHRGMQGGLVGTDETVALTAFV
VIALHHGLAVFQDENSQQLKKRVEASITKANSFLGQKASAGLLGAHASAITAYALTLTKA
SEDLRNVAHNSLMAMAEETGENLYWGSAIGSQDNVVSSTPAPRNPSEPVPQAPALWIETT
AYGLLHLLLREGKGEMADKVATWLTHQGSFQGGFRSTQDTVVTLDALSAYWIASHTTEEK
ALNVTLSSMGRNGYKSHLLQLNNHQVKGLEEELKFSLGSTINVKVGGNSKGTLKILRTYN
VLDMKNTTCQDLRIEVTVTGYVEYTREANEDYEYDYDMPAADDPSVHSQPVTPLQLFEGR
RSRRRREAPKAADEQESRVQYTVCIWRNGNLGLSGMAIADITLLSGFQALRADLEKLTSL
SDRYVSHFETDGPHVLLYFDSVPTTRECVGFGALQEVAVGLVQPASAVLYDYYSPDHKCS
VFYAAPTKSKLLSTLCSADVCQCAEGKCPRQRRSLERGVEDKDGYRMKFACYYPRVEYGF
QVKVLREDSRAAFRLFETKITQVLHFTKDAKASIGQTRNFLVRASCRLRLEPSKEYLIMG
MDGVTSDLKGDPQYLLDSNTWIEEMPSERLCRSTRQRAACGQLNDFLQEYSSQGCQV
NT seq 5214 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcctctggggcctggcctgggcattcagcttcttcgcctcctctctgcagaag
cccaggttgctcctgttctccccttctgtggttaatttggggacccccctgtcagtaggg
gtgcagctcctggatgcccctgcaggacaggaggtgaaaggctcagtgtacctcagaaac
ccaacaagcggtccctgctccccaaagaaggactttaagctcagctcgggaaatgacttt
gtgcttctcagacttgaggtcccactgaaagatgtgaggagttgtggcctctttggcctg
cgcagagccccccacatccagctggtggctcactctccgtggctaaagaacacagcatcc
aaagccaccgagactcagggggtcaacctgcttttctcttcccgacgaggccacatcttt
gtgcagaccgatcagcctatctataaccctgggcagcgggttcgttatcgggtctttgca
ctggatcaaaagatgcgtccatctactgacaccctcacggtcacagtggagaactcccat
ggcctccgtgtacgcaagaaggaggtatttgcccccacatccatcttccaagatgacttc
ataattccagacatctcagagccggggacctggaagatctcagctaggttctcagatggc
ctcgagtccaacagaagcacccacttcgaagtgaagaaatatgtccttcccaactttgag
gtgaagcttactccttggaagccatatatcctgacagtgcctagctaccgtgaagaaata
caattagacgtccaggccagatacgtctacgggaagcccgtgcagggcgtggcatatacc
cgcttcgcactcatggatgagcaggggaagaagtctttcctccggggcctagagacccag
accaagttggtggaaggccagactcacatctccatctcaagggaccagttccaggctgcc
ctgggtaaagtgaatactgagatcggagacctggaggggctgcggctctacgctgccgta
gctgtcattgagtctccaggaggagagatggaggaggcggagctcacatcctggcccttc
gtgtcatctgccttctccttggatctcagccacaccaagcagcatcttgtgcccggggcc
cccttcctgctgcaggccctggttcgagaaatgtcaggctctgaagcctctgatgttcct
gtcaaagtctctgccacattgttgtctgggtccgactcgaaagtccttgactttcaacag
aacaccaatgggattggccaagtcagcttttccatccatgtcccgccaaccatcaccgaa
cttcgactcttggtatctgccggttccctctacccagctgtagccaagctcaccgtgcaa
gccccaccttcaagaggccccggctttctgtccattgagccattagaccttcggtcccct
cgtgtgggggacaccttcgtcctgagccttcgaaccgtgggcatccctatgcctaccttc
tctcattactactacatgatcatctccagaggccagatcatggccatgagtcgggagccc
aggagggccctgacctccatctctgtcttggtggaccatcacctggctccctctttctac
tttgtggcctacttctatcaccaaggactcccagtggccaactccctgctcatcaacgtc
cagcccggggactgtgagggcaagctggaattgaaggtggatggtgccaaggagtatcgc
aatggagacagcatgaagctccaacttcaaactgactctgaagccctggtggcactggga
gctgtggacacagctctgtatgctgtgggtggccggtctcacaaacccctcgacatgagc
aaggtctttgaagtaatgaacagctacaaccttggctgtggtcccggaggcggggacgat
gcccttcaggtgttccagactgctggtctggccttttctgacggtgatcgactaactcag
accaaagagaacctgagctgtcccaaggagaagaaaagtcggcaaaagcgaaatgttaac
ttccagaaggctattagcgagaagttgggccagtattcctctccagacaccaagcgctgc
tgccaggatgggatgaccaagctgcccatggcacgcacctgcgagcagagggcagcccgc
gtgcctcagccagcctgccgggagcccttcttgtcctgttgcaagtttgctgaggacctc
cgcaggaaccagaccaggagccaggcgggcctcgcccgagcccaggacatgctgcaggag
gaggatctgatagatgaagatgacattctcgtgcgcagcttcttcccagagaactggctc
tggagagtggaacctgtggaccgctccaaactgttgactgtgtggctccctgactctctg
accacatgggagattcatggtgtgagcctgtccaaaagcaaaggcttgtgtgtagccaag
ccaactcgcgtgcgagtgttccgagaattccacctgcacctgcgcctgcccatctctgtc
cggcgcttcgagcagcttgaattacggcccgttctctacaactatctgagtgaggacgtg
actgtaagtgtccatgtgtccccagtggaggggctgtgcctggctggtggtggattgctg
gcccagcaagtatcagtgcctgcaggctccgcccggcctgtggccttctctgtggtaccc
acagctgctgccagcatacccctgaaagtggtggctcgggggtcttttactataggggat
gctgtgtctaagattctccaaattgagaaggaaggggccatccacagagaagagatagtc
tacaacctcgaccccctaaataaccttggtcggagtttggaaatccctggcagctcagac
cccaacgtcattcctgatggagatttcagcagcttcgtcagggttacagcctccgaaccc
ttggagactttgggctccgaaggcgccttgtccccaggcggagtggcctccctcctgagg
ctccctagaggctgtgcagaacaaaccatgatctatttggcccctaccctgactgcttcc
cactacctggacaggacggagcagtggagcaaactgccccctgagacaaaggaccatgct
gtggatctgattcagaaaggccacatgcggatccagcagtttcggaagaaagatggctcc
tttggggcatggttacaccgggacagcagcacctggctcacggcttttgtgctgaagatt
ctgagtctggcccaggaacagattggtgactcccccgagaagctgcaagagaccgctggg
tggctgctgggccagcagctggacgatggctcattccacgacccgtgtccagtcatccac
agaggcatgcaggggggcttggtgggaaccgatgagaccgtggcactgaccgcctttgtg
gtcatcgcccttcaccacgggctggccgtcttccaggacgagaactcacagcagctgaag
aagagggtggaagcctccatcacgaaggcgaactcgttcttggggcagaaggcaagtgct
gggctcctgggtgcacacgcatccgccatcacagcctatgccctgacactgaccaaggcc
tcggaggacctgcggaatgttgcccacaacagcctgatggccatggctgaggaaacaggg
gaaaacctctactggggctcagccattggctctcaggacaacgttgtgtcgtccacccca
gcccctcgtaatccctcagaacctgtgccccaggccccagccctgtggatcgaaaccaca
gcctacggcctgctacatctgctgctgcgggaggggaagggagaaatggctgacaaggtg
gcaacctggctcacacaccagggaagcttccaagggggattccgcagtacccaggacact
gtggtcaccctggatgccctgtctgcatactggatcgcttcacacaccaccgaggagaag
gcactcaatgtgactctcagctccatgggccgcaatgggtacaagtcccacctgctacag
ctgaacaaccaccaagtcaagggcctggaggaggagctgaagttctccctgggcagcacc
atcaatgtgaaagtgggaggaaacagcaaaggcaccttaaagatccttcgtacctacaac
gtcctggacatgaagaacacaacatgccaagaccttcggatagaagtgacggtcacaggc
tatgtggaatatacaagggaggccaacgaagactatgaatacgactatgatatgccagcc
gcagatgaccccagtgtccactcgcagcctgtgacacccctgcagctgtttgagggtcgt
cggagccgccgcaggagggaggcccccaaggctgcggatgagcaggagtccagagtgcag
tacaccgtgtgcatctggcggaacggtaacctggggctgtctgggatggccattgctgac
atcaccctcctgagtggattccaagccctgagggccgacctggagaagctgacctccctc
tctgaccgttacgtgagtcactttgagaccgacgggccccacgtcctactatactttgac
tcggtcccgaccacccgggagtgtgtgggctttggagccttgcaggaggtggccgtgggg
ctggtgcagccagccagtgctgtcctatatgactactacagccctgatcacaagtgctct
gtgttctatgctgcacccaccaagagcaagctcctctccaccttgtgctctgcagacgtc
tgccagtgcgctgaagggaagtgtcctcgacagcgaaggtcactggagcgaggggtggag
gacaaggatggttaccggatgaagttcgcctgctattatccccgagtggagtatggcttc
caggttaaggttctccgagaagacagcagagctgccttccgcctctttgagaccaagatc
acccaagtcctgcatttcacaaaggatgccaaggcctccataggtcagacccgcaacttt
ctggtccgggcctcttgccgccttcgtttggagcctagcaaagagtacttaatcatgggg
atggacggagtcaccagtgacctcaagggagacccccagtacttgctggactcaaatact
tggatcgaggagatgccatctgagcgcctgtgcaggagcacccgtcagcgggcagcctgt
ggccagctcaatgactttctgcaggagtacagcagccaggggtgccaggtgtga

DBGET integrated database retrieval system