KEGG   Rattus norvegicus (rat): 24248
Entry
24248             CDS       T01003                                 

Gene name
Cat
Definition
(RefSeq) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00380  Tryptophan metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04068  FoxO signaling pathway
rno04146  Peroxisome
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    24248 (Cat)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    24248 (Cat)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    24248 (Cat)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    24248 (Cat)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    24248 (Cat)
   04213 Longevity regulating pathway - multiple species
    24248 (Cat)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    24248 (Cat)
   05022 Pathways of neurodegeneration - multiple diseases
    24248 (Cat)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     24248 (Cat)
SSDB
Motif
Pfam: Catalase Catalase-rel Erythro-docking
Other DBs
NCBI-GeneID: 24248
NCBI-ProteinID: NP_036652
RGD: 2279
Ensembl: ENSRNOG00000008364
UniProt: P04762
Position
3
AA seq 527 aa
MADSRDPASDQMKQWKEQRAPQKPDVLTTGGGNPIGDKLNIMTAGPRGPLLVQDVVFTDE
MAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGES
GSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDAMLFPSFIHSQKRNPQTHLKDPD
MVWDFWSLCPESLHQVTFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQ
GIKNLPVEEAGRLAQEDPDYGLRDLFNAIASGNYPSWTFYIQVMTFKEAETFPFNPFDLT
KVWPHKDYPLIPVGKLVLNRNPANYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFAYPD
THRHRLGPNYLQIPVNCPYRARVANYQRDGPMCMHDNQGGAPNYYPNSFSAPEQQGSALE
HHSQCSADVKRFNSANEDNVTQVRTFYTKVLNEEERKRLCENIANHLKDAQLFIQRKAVK
NFTDVHPDYGARVQALLDQYNSQKPKNAIHTYVQAGSHIAAKGKANL
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcggacagccgggacccagccagcgaccagatgaagcagtggaaggagcagcgggcc
cctcagaaacccgatgtcctgaccaccggaggcgggaacccaataggagataaacttaat
atcatgactgcggggccccgagggcccctcctcgttcaagatgtggttttcaccgacgag
atggcacactttgacagagagcggattcctgagagagtggtacatgcaaagggagcaggt
gcttttggatactttgaggtcacccacgatattaccagatactccaaggcaaaggtgttt
gagcatattgggaagaggactcctattgccgtccgattctccacagtcgctggagagtca
ggctcagctgacacagttcgtgaccctcgtgggtttgcagtgaaattctacactgaagat
ggtaactgggaccttgtgggaaacaacacccctattttcttcatcagggatgccatgttg
tttccatcctttatccatagccagaagagaaacccacaaactcacctgaaggaccctgac
atggtctgggacttctggagtctttgtccagagtctctccatcaggttactttcttgttc
agcgaccgagggattccagatggacatcggcacatgaatggctatggctcacacaccttc
aagctggttaatgcgaatggagaggcagtgtactgcaagttccattacaagactgaccag
ggcatcaaaaacttgcctgttgaagaggcaggaagacttgcacaggaagacccggattat
ggcctccgagatcttttcaatgccatcgccagtggcaattacccatcctggactttttac
atccaggtcatgactttcaaggaggcagaaaccttcccatttaatccatttgacctgacc
aaggtttggcctcacaaggactaccctcttataccagttggcaaactggtcttaaacaga
aatcctgctaattattttgctgaagttgaacagatggcttttgacccaagcaacatgccc
cctggcattgagcccagcccggacaagatgctccagggccgcctttttgcttacccagac
actcaccgccaccgcctgggaccaaactatctgcagatacctgtgaactgtccctaccgt
gctcgcgtggccaactaccagcgcgatggccccatgtgcatgcatgacaaccagggtggt
gctcccaactactaccccaacagcttcagcgcaccagagcagcagggctcggccctggag
caccatagccagtgctctgcagatgtgaagcgcttcaacagtgctaatgaagacaacgtc
actcaggtgcggacattctatacgaaggtgttgaatgaggaggagaggaaacgcctgtgt
gagaacattgccaaccacctgaaagatgctcagcttttcattcagaggaaagcggtcaag
aatttcactgacgtccaccctgactacggggcccgagtccaggctcttctggaccagtac
aactcccagaagcctaagaatgcaattcacacctacgtacaggccggctctcacatagct
gccaagggaaaagctaacctgtaa

DBGET integrated database retrieval system