KEGG   Rattus norvegicus (rat): 24255
Entry
24255             CDS       T01003                                 

Gene name
Cftr
Definition
(RefSeq) cystic fibrosis transmembrane conductance regulator
  KO
K05031  cystic fibrosis transmembrane conductance regulator [EC:5.6.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04024  cAMP signaling pathway
rno04152  AMPK signaling pathway
rno04530  Tight junction
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    24255 (Cftr)
  09132 Signal transduction
   04024 cAMP signaling pathway
    24255 (Cftr)
   04152 AMPK signaling pathway
    24255 (Cftr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    24255 (Cftr)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    24255 (Cftr)
   04972 Pancreatic secretion
    24255 (Cftr)
   04976 Bile secretion
    24255 (Cftr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24255 (Cftr)
Enzymes [BR:rno01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.6  channel-conductance-controlling ATPase
     24255 (Cftr)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC7 subgroup
    24255 (Cftr)
SSDB
Motif
Pfam: ABC_membrane CFTR_R ABC_tran AAA_21 AAA_29 T2SSE RsgA_GTPase AAA_16 AAA_22 TsaE MMR_HSR1 DUF87 NTPase_1 MeaB AAA_30 NB-ARC AAA_23 Intein_splicing Zeta_toxin
Other DBs
NCBI-GeneID: 24255
NCBI-ProteinID: NP_113694
RGD: 2332
Ensembl: ENSRNOG00000055103
UniProt: P34158
Position
4
AA seq 1476 aa
MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSSDSADHLSEKLEREWDRE
QASKKKPQLIHALRRCFVWRFVFYGVLLYLGEVTKAVQPVLLGRIIASYDPDNTEERSIA
IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQL
ISLLSNNLNKFDEGLALAHFIWIAPLQVVLLMGLLWDLLQFSAFCGLGLLIVLVIFQAIL
GKMMVKYRDKRAAKINERLVITSEVIDNIYSVKAYCWESAMEKIIESLREEELKMTRRSA
YMRFFTSSAFFFSGFFVVFLSVLPYTVINGIVLRKIFTTISFCIVLRMSVTRQFPTAVQI
WYDSLGMIRKIQDFLQTQEYKVLEYNLMFTGLVMENVTAFWEEGFQELLEKVQLNNDDRK
TSNGENHLSFSHLCLVGNPVLKNINLNIKKGEMLAITGSTGAGKTSLLMLILGELEASEG
IIKHSGRVSFSSQISWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQEDITKFAEQDNTV
LGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEQIFESCVCKLMASKTR
ILVTSKMEQLKKADKILILHEGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSS
ILTETLRRFSVDDASTTWNKAKQSFRQTGEFGEKRKNSILSSFSSVKKISIVQKTPLSIE
GESDDLQERRLSLVPDSEHGEAALPRSNMITAGPTFPGRRRQSVLDLMTFTPSSVSSSLQ
RTRASIRKISLAPRISLKEEDIYSRRLSQDSTLNITEEINEEDLKECFFDDMVKIPTVTT
WNTYLRYFTLHRGLFAVLIWCVLVFLVEVAASLFVLWLLKNNPVNGGNNGTKIANTSYVV
VITSSSFYYIFYIYVGVADTLLALSLFRGLPLVHTLITASKILHRKMLHSILHAPMSTFN
KLKAGGILNRFSKDIAILDDFLPLTIFDFIQLLFIVVGAIIVVSALQPYIFLATVPGLAV
FILLRAYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFRRQTYFETLFHKALNLH
TANWFMYLATLRWFQMRIDMIFVLFFIVVTFISILTTGEGEGTTGIILTLAMNIMSTLQW
AVNSSIDTDSLMRSVSRVFKFIDIQTEESICTKIMKELHSEDSPNALVIKNEHVKKCDTW
PSGGEMVVKDLTVKYVDDGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRMLNIK
GEIQIDGVSWNSMTLQEWRKAFGVITQKVFIFSGTFRQNLDPNGKWRDEEIWKVADQVGL
KSVIEQFPGQLNFTLVDGGYVLSHGHKQLMCLARSVLSKAKIILLDEPSANLDPITYQVI
RRVLRQAFAGCTVVLCEHRIEAMLDCQRFLVIEQGNVWQYESLQALLSEKSVFQRALSSS
EKMKLFHGRHSSKQKPRTQITAVKEETEEEVQETRL
NT seq 4431 nt   +upstreamnt  +downstreamnt
atgcagaagtcgcctctggagaaagccagctttatctccaaactcttcttcagctggacc
acaccaattttgagaaaagggtacagacaccacttggagctgtcagacatataccaagcc
ccttcttctgattcagctgaccacctgtctgaaaagctagaaagagaatgggacagggaa
caagcttccaaaaagaagccccagcttatccacgccctccggcgatgctttgtctggaga
ttcgtcttctacggagtcttgttatacctcggggaagtcaccaaggctgtccagcctgtc
ttgctaggaagaatcatagcatcctatgatccagacaacacggaggagcgttccattgcc
atttacctaggcataggcttatgcctcctcttcattgtcaggacactgcttctgcaccca
gctatttttggccttcatcacattggaatgcagatgagaatagccatgtttagcttgatt
tataagaagactttaaagttgtcaagccgtgttcttgataaaataagtattggacaactt
attagtcttctttccaacaacctgaacaaatttgatgaaggacttgccttggcacatttt
atatggattgctcctttacaagtggttcttctgatggggcttctctgggacttgttacag
ttctcagccttctgtggccttggtttactgatagtcttggttatttttcaagctatctta
gggaagatgatggtgaagtacagagataaaagagctgcaaagatcaatgaaagacttgtg
atcacatcagaagttattgacaatatctattctgttaaggcatattgttgggaatcagcg
atggagaagataattgaaagcttgagagaggaggaactgaaaatgacccggaggtcagcc
tatatgaggttcttcactagctctgccttcttcttttcagggttttttgtagtcttttta
tctgtgcttccctacacagtcatcaatggaatcgtcctccgaaaaatattcacaaccatt
tcattctgcattgtcctgcgtatgtcagtcacacggcaattccccactgctgtacagata
tggtatgattctttgggaatgataagaaaaatacaggatttcctacagactcaagaatat
aaagtgctggagtataacttaatgttcacaggcctagtcatggagaatgtaacagcattt
tgggaggagggatttcaggaattactggagaaagtacaactaaacaatgatgacagaaaa
acttccaatggtgagaaccacctcagttttagtcatctctgtctagtgggaaatcctgtg
ttgaaaaacatcaatttgaatataaagaaaggagagatgttggctattactggatctact
ggagcaggaaagacatcactcctgatgctgatactgggagaactggaagcgtcagaggga
attattaagcacagtggaagagtttcattctcctctcaaatttcttggattatgccgggt
actatcaaagaaaatatcatctttggtgtttcctatgatgagtacagatataagagtgtt
gtcaaagcttgccaactacaggaggacatcaccaagtttgcagaacaagacaacacagtt
cttggagaaggtggagtcacactcagtggaggtcaacgtgcaagaatttctttagcaaga
gcagtatataaagatgctgatttgtacctgttagattcccccttcggatatctagatgtt
ttaactgaagaacaaatatttgaaagttgtgtctgtaaattgatggccagcaaaactagg
attctggtcacatctaaaatggagcagttaaagaaagctgacaagatactcattttgcat
gagggcagcagctatttttatgggacgttttctgaactacaaagtctacgtccagacttc
agttccaaactcatggggtatgatacttttgaccagtttactgaggaaagaaggagttca
attctaactgagaccttacgcaggttctcagtggacgatgcctctaccacctggaacaaa
gccaaacagtcatttagacagactggagagtttggagaaaaaaggaagaactctattcta
agttcattcagctctgtgaagaaaatttccattgtgcaaaagactccattgtccatagaa
ggagaatctgatgacctccaagaaaggagactgtccctggttccagactctgaacatgga
gaggccgctctgcctcgcagcaacatgatcaccgccgggcccacgtttccaggcagaaga
agacagtctgttttggatcttatgacattcacacccagctcagtctccagcagtctccag
aggaccagagcttctattcgaaaaatatccttagcccctcggataagcttaaaggaagag
gatatatattcaaggcgattatcgcaagatagcacactgaacatcaccgaagaaattaat
gaagaagatttaaaggagtgtttttttgatgatatggtaaagatccccacggtgacaaca
tggaacacataccttcgatatttcacgctccacagaggcttatttgcagtgctgatttgg
tgcgtgctggtttttctggttgaggtggctgcttctttatttgtgttgtggttgcttaaa
aacaaccccgttaatggtggaaacaatggcactaaaattgccaatacctcctatgttgtg
gtcatcaccagttccagcttctattacattttttacatttacgtgggagtggctgacact
ttgcttgctctgagcctcttcagaggtttgcccctggtgcatacgttaatcacagcatca
aaaattttgcacaggaaaatgttacattctattcttcatgcccctatgtcaaccttcaac
aagctgaaagcaggtgggattcttaacagattctccaaagatatagcaattttggatgac
tttctgcctcttaccatatttgacttcatccagttgctgttcattgtggtcggagcaata
atagttgtctcggctttacaaccctacatcttcctagcaacggtgccagggctagcagtc
ttcattttactgagggcatacttccttcatacctcccaacagctcaaacaactggaatct
gaaggcaggagtccaattttcacgcaccttgttacaagcttaaaaggactgtggacactt
cgagccttccgacgccagacttactttgaaaccctattccacaaagctctgaatttgcac
actgccaactggtttatgtatctggcaaccttgcgctggttccagatgagaatagacatg
attttcgtcctcttcttcattgttgttaccttcatctccattttaacaacaggtgaagga
gaaggaacgactggtattattctaactttagctatgaatattatgagtactttgcaatgg
gctgtgaactcaagcattgatacagatagcttgatgcgatctgtgagcagagtctttaag
tttattgatatacaaacagaagaaagtatatgtaccaagataatgaaagaactacatagt
gaagactcacctaatgctttagtcattaagaatgaacatgtgaagaaatgtgatacctgg
ccctctggaggtgaaatggttgtcaaagaccttactgtgaaatatgtggatgatgggaat
gccatattagagaacatttctttttcaataagtcctggccagagggtggggctcttagga
agaactggctcaggaaaaagtactttgctgtcagcctttttacgaatgttgaacattaaa
ggcgaaatacagatcgatggtgtctcctggaactcaatgaccttacaagaatggagaaaa
gcttttggagtgataacacagaaagtatttatcttttctggaacattcagacaaaacttg
gatcccaatggaaaatggagagatgaagaaatatggaaagttgcagatcaggttggcctc
aagtctgtgatagagcagtttcctggacagctcaactttacccttgtggatgggggttat
gtgctaagccatggtcacaagcagttgatgtgcttggcccgatctgttctcagtaaggcc
aagatcatactgcttgatgagcctagtgccaatctagaccccataacataccaagtgatt
cgacgagttctaagacaagccttcgctggttgcacagtagtcctctgtgaacacaggata
gaagcaatgttggactgtcagcgatttttggtcatagagcagggcaatgtctggcagtat
gaatccctccaggcacttctgagcgagaagagtgtcttccagcgagcccttagctcctca
gaaaagatgaagctcttccacggccggcactccagcaagcagaagcctcggacacagatc
actgctgtgaaagaggagacggaggaagaagtgcaagagacccggctctag

DBGET integrated database retrieval system