KEGG   Rattus norvegicus (rat): 24294
Entry
24294             CDS       T01003                                 

Gene name
Cyp11b2, Cp45as, Cyp11b3, RNCP45AS
Definition
(RefSeq) cytochrome P450, family 11, subfamily b, polypeptide 2
  KO
K00497  steroid 11beta-monooxygenase [EC:1.14.15.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Module
rno_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    24294 (Cyp11b2)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    24294 (Cyp11b2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24294 (Cyp11b2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    24294 (Cyp11b2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     24294 (Cyp11b2)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP11 family
   24294 (Cyp11b2)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 24294
NCBI-ProteinID: NP_036670
RGD: 2454
Ensembl: ENSRNOG00000030111
Vega: OTTRNOG00000000262
Position
7q34
AA seq 502 aa
MAMALRVTADVWLARPWQCLHRTRALGTTATLAPKTLKPFEAIPQYSRNKWLKMIQILRE
QGQENLHLEMHQAFQELGPIFRHSAGGAQIVSVMLPEDAEKLHQVESILPRRMHLEPWVA
HRELRGLRRGVFLLNGADWRFNRLKLNPNVLSPKAVQNFVPMVDEVARDFLEALKKKVRQ
NARGSLTMDVQQSLFNYTIEASNFALFGERLGLLGHDLNPGSLKFIHALHSMFKSTTQLL
FLPRSLTRWTSTRVWKEHFDAWDVISEYANRCIWKVHQELRLGSSQTYSGIVAALITQGA
LPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPDVQQALRQETLAAEASIAANPQKA
MSDLPLLRAALKETLRLYPVGGFLERILNSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFP
RPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMLKTFQVETLRQEDV
QMAYRFVLMPSSSPVLTFRPVS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcaatggctctcagggtgacagcagatgtgtggctggcaagaccctggcagtgcctg
cacaggacgagggcactgggcactacggcaacactggcccccaagacactgaagcccttt
gaagccataccacaatactccaggaacaagtggctgaagatgatacagatcctgagggag
cagggccaagagaacctacacctggagatgcaccaggccttccaggagctggggcccatt
ttcaggcacagtgcagggggagcacagattgtgtctgtgatgctgcctgaggacgctgag
aagctgcaccaggtggagagtatcctcccgcgtcggatgcacctggagccgtgggtggcc
cacagggaactccgtggcctgagacgtggtgtgttcttgctaaatggggctgactggcgc
ttcaaccgactgaaactgaacccaaacgtgctgtcaccaaaagctgttcaaaattttgtc
cccatggtggacgaggtagcaagggacttcttggaggccctgaaaaagaaggtgcgtcag
aatgctcgagggagccttaccatggatgtccagcaaagtctcttcaactacactatagaa
gccagcaactttgcactttttggagagaggctgggcctccttggtcatgacctgaaccct
ggtagcctgaagttcatccatgccctacattcaatgttcaagtccaccacacagctcctg
ttcttacccagaagcttgactcgctggacaagcacccgggtgtggaaagaacattttgat
gcctgggatgtcatctctgagtatgccaacagatgtatctggaaggtgcaccaggaactc
agactcggcagctctcagacctacagtggcattgtggcagcactaataactcagggagct
ttacctctggacgccatcaaagccaactctatggagctcactgctgggagcgttgacacg
acagcaatccccttggtaatgaccctttttgagctggctcggaacccagatgttcagcag
gccctgcggcaggagaccctggcagctgaggccagcatcgctgctaatccccagaaggcc
atgtcagacctgcccttgctgcgggctgcccttaaagagaccttgagactctaccctgtt
ggtggctttttggagagaatcctaaactcagacctggtgcttcagaactatcatgtccct
gctgggacgttggtcctactttatctgtactccatgggccgaaaccctgcagtgttccca
agacctgagcgctatatgcctcagcgctggctggagaggaaaaggagtttccagcatctg
gccttcggctttggggtgcgccagtgcctggggcggcgcctggcagaggtggagatgctg
ctcctgcttcaccatatgctgaaaaccttccaggtggagacactgagacaagaggatgtg
cagatggcctatcgctttgttttgatgcccagctctagtcctgtcctcactttccggccc
gtcagctag

DBGET integrated database retrieval system