KEGG   Rattus norvegicus (rat): 24330
Entry
24330             CDS       T01003                                 

Gene name
Egr1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04371  Apelin signaling pathway
rno04912  GnRH signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05020  Prion disease
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    24330 (Egr1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    24330 (Egr1)
   04928 Parathyroid hormone synthesis, secretion and action
    24330 (Egr1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24330 (Egr1)
  09164 Neurodegenerative disease
   05020 Prion disease
    24330 (Egr1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24330 (Egr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24330 (Egr1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    24330 (Egr1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED Cornifin zf-H2C2_5 zf-C2H2_8
Other DBs
NCBI-GeneID: 24330
NCBI-ProteinID: NP_036683
RGD: 2544
Ensembl: ENSRNOG00000019422
UniProt: P08154
Position
18
AA seq 508 aa
MDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGGNNSSSSSSSSSGGGGGGGSNSGSSAFNP
QGEPSEQPYEHLTTESFSDIALNNEKALVETSYPSQTTRLPPITYTGRFSLEPAPNSGNT
LWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSSSASQSPPLSCAVPSNDSSPIYSAAP
TFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPATKGGFQVPMIPDYLFPQQQGDLSLG
TPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQDLKALNNTYQSQLIKPSRMRKYPNR
PSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHI
RTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASSAASSLSSYPSPVA
TSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTYASVPPAFPAQVSTFQS
AGVSNSFSTSTGLSDMTATFSPRTIEIC
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggacaactaccccaaactggaggagatgatgctgctgagcaacggggctccccagttc
ctcggtgctgccggaaccccagagggcagcggcggcaataacagcagcagcagcagcagc
agcagcagcgggggcggtggtgggggcggcagcaacagcggcagcagcgctttcaatcct
caaggggagccgagcgaacaaccctacgagcacctgaccacagagtccttttctgacatc
gctctgaataacgagaaggcgctggtggagacaagttatcccagccaaactacccggttg
cctcccatcacctatactggccgcttctccctggagcctgcacccaacagtggcaacact
ttgtggcctgaaccccttttcagcctagtcagtggccttgtgagcatgaccaaccctcca
acctcttcatcctcagcgccttctccagctgcttcatcgtcttcctctgcctcccagagc
ccacccctgagctgtgccgtgccgtccaacgacagcagtcccatttactcagctgcaccc
acctttcctactcccaacactgacatttttcctgagccccaaagccaggcctttcctggc
tctgcaggcacagccttgcagtacccgcctcctgcctaccctgccaccaagggtggtttc
caggttcccatgatccctgactatctgtttccacaacaacagggagacctgagcctgggc
accccagaccagaagcccttccagggtctggagaaccgtacccagcagccttcgctcact
ccactatccactatcaaagccttcgccactcagtcgggctcccaggacttaaaggctctt
aataacacctaccagtcccaactcatcaaacccagccgcatgcgcaagtaccccaaccgg
cccagcaagacacccccccatgaacgcccgtatgcttgccctgttgagtcctgcgatcgc
cgcttttctcgctcggatgagcttacacgccacatccgcatccatacaggccagaagccc
ttccagtgtcgaatctgcatgcgtaatttcagtcgtagtgaccaccttaccacccacatc
cgcacccacacaggcgagaagccttttgcctgtgacatttgtgggagaaagtttgccagg
agtgatgaacgcaagaggcataccaaaatccacttaagacagaaggacaagaaagcagac
aaaagtgtcgtggcctcctcagctgcctcttccctctcttcctacccatccccagtggct
acctcctacccatcccccgccaccacctcatttccatccccagtgcccacctcttactcc
tctccgggctcctctacctacccgtctcctgcacacagtggcttcccatcgccctcggtg
gccaccacctatgcctccgtcccacctgctttccctgcccaggtcagcaccttccagtct
gcaggggtcagcaactccttcagcacctcaacgggtctttcagacatgacagcaaccttt
tctcctaggacaattgaaatttgctaa

DBGET integrated database retrieval system