KEGG   Rattus norvegicus (rat): 24338
Entry
24338             CDS       T01003                                 

Gene name
Ephb1, Ephb2, Erk, elk
Definition
(RefSeq) Eph receptor B1
  KO
K05110  Eph receptor B1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    24338 (Ephb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24338 (Ephb1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24338 (Ephb1)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   24338 (Ephb1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N ABC1 DAP10 VSP EGF_2
Other DBs
NCBI-GeneID: 24338
NCBI-ProteinID: NP_001097998
RGD: 2556
Ensembl: ENSRNOG00000007865
UniProt: P09759
Position
8q32
AA seq 984 aa
MALDCLLLFLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKAGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPSEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
KKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGVTLAG
HQKKILSSIHSMRVQMNQSPSVMA
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggccctggattgcctgctgctgttcctcctggcatctgcagtggccgcgatggaagaa
acattgatggacacaaggactgccactgcagagttgggatggacggccaaccctgcctct
gggtgggaagaagtcagtggctacgatgaaaacctgaacaccatccgtacttaccaagtg
tgcaacgtctttgaacccaaccagaacaactggctgcttaccacctttatcaacagacgg
ggcgcccatcgcatctatacagagatgcgcttcactgtgagggactgcagcagccttcca
aatgtcccaggctcctgcaaagagaccttcaacttatactactatgagactgactctgtc
attgccaccaagaagtcagccttctggtctgaagccccctacctcaaagttgacaccatt
gctgcagatgagagcttctcccaggtggattttgggggaaggttgatgaaggtcaacaca
gaagtcaggagctttgggcctcttactaggaatggtttttacctcgctttccaggattat
ggagcctgtatgtctctactttctgtccgtgtcttcttcaaaaagtgtcccagcattgtg
caaaattttgcagtgttcccagaaaccatgacaggagcagagagcacatctctggtgatt
gctcggggcacatgcatccctaatgcagaagaagtggatgtgcccataaaactctactgc
aatggagatggagagtggatggtgcccattgggcgctgcacctgtaaggctggctatgaa
cctgagaacagcgtggcctgcaaggcctgtcctgcgggaaccttcaaggccagccaggaa
gctgaaggctgctcccactgcccctccaacagccgctccccttcagaggcgtctcccatc
tgcacctgccggactggctattaccgagcagactttgatcccccagaagtggcgtgcact
agtgtcccatcaggccctcgaaatgtcatctccattgtgaatgagacatctatcattcta
gagtggcaccctccaagagagaccggtgggcgagatgatgtgacctacaacatcatctgc
aagaagtgcagagcagaccgccggagttgctcccgctgcgatgacaatgtggagtttgta
cccagacagctgggcttgactgagtgtcgtgtctctatcagtagcctatgggcccacacc
ccatacacttttgatatccaggccatcaatggagtctctagcaagagtcccttcccccca
cagcatgtctctgtcaacatcaccacaaaccaagctgccccctccactgttcctatcatg
caccaggtcagtgccaccatgaggagcatcaccttgtcatggcctcagccggagcagcct
aatggcatcatcctggactatgagatccggtactatgagaaggagcacaatgagttcaac
tcttccatggccaggagccagaccaacacggcacgtatcgatgggctacggcccggcatg
gtgtatgtggtccaggtacgagctcgaaccgtggctggctatggcaagttcagtggcaag
atgtgcttccagactctgacagatgatgattacaagtcggagctgagagagcagctaccc
ctgatcgctggctctgcagcagctggggttgtatttgttgtgtctctggtggctatctcc
attgtctgcagcaggaaacgagcttacagcaaagaggctgtgtacagtgataaacttcag
cattacagcacaggccgaggctccccagggatgaagatctacattgacccgttcacttat
gaggaccctaatgaagctgtccgggagtttgccaaggagattgatgtgtcttttgtgaaa
attgaagaggtcatcggagcaggggagtttggagaagtgtacaagggccgattgaagctg
ccaggcaagagggaaatctatgtggccatcaagaccctgaaagctgggtactcagagaaa
cagcgtcgggattttctgagcgaggcgagcatcatgggccagtttgaccatcccaacatc
attcgcctagagggtgttgtcaccaagagccgacctgtcatgatcattacggagttcatg
gagaatggcgctttagactctttcctccggcaaaatgacggacagttcaccgtgatccag
cttgtggggatgctgaggggcatcgctgctggcatgaagtacctatctgagatgaattat
gtgcaccgggacctggctgctaggaacattctggtgaacagcaacctggtgtgcaaagtg
tctgactttggcctctctcgctacctccaggatgacacctcagaccccacctacaccagc
tccttgggagggaagatacctgttagatggacagctccagaggccatcgcctaccgcaag
tttacgtcagccagcgatgtctggagctacgggattgtcatgtgggaagtaatgtcattt
ggagagagaccttactgggatatgtccaatcaagatgtcatcaatgccattgagcaggac
taccggctgccccctcctatggactgcccagctgccctgcaccagctcatgctggactgt
tggcagaaggatcgaaatagccggccccgttttgcagagatcgtcaacaccctggacaag
atgatccggaacccagctagtctcaagactgtggcaaccatcaccgctgtgccttcccaa
cccctgcttgaccgctctatcccagacttcacggcctttaccaccgtggatgactggcta
agtgccatcaaaatggtccagtacagggacagcttcctcaccgctggcttcacctccctc
cagctggtcacccagatgacatcagaagacctcctgagaataggggtcaccttggcaggc
catcagaagaagattcttagcagcatccactcgatgagggtccagatgaaccagtcaccg
tcggtaatggcatga

DBGET integrated database retrieval system