KEGG   Rattus norvegicus (rat): 24414
Entry
24414             CDS       T01003                                 

Gene name
Grm1, Gprc1a
Definition
(RefSeq) glutamate receptor, metabotropic 1
  KO
K04603  metabotropic glutamate receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04540  Gap junction
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04730  Long-term depression
rno04742  Taste transduction
rno04915  Estrogen signaling pathway
rno05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    24414 (Grm1)
   04020 Calcium signaling pathway
    24414 (Grm1)
   04072 Phospholipase D signaling pathway
    24414 (Grm1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24414 (Grm1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24414 (Grm1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24414 (Grm1)
  09156 Nervous system
   04724 Glutamatergic synapse
    24414 (Grm1)
   04720 Long-term potentiation
    24414 (Grm1)
   04730 Long-term depression
    24414 (Grm1)
   04723 Retrograde endocannabinoid signaling
    24414 (Grm1)
  09157 Sensory system
   04742 Taste transduction
    24414 (Grm1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    24414 (Grm1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24414 (Grm1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24414 (Grm1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24414 (Grm1)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   24414 (Grm1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438 AAA_34
Other DBs
NCBI-GeneID: 24414
NCBI-ProteinID: NP_058707
RGD: 2742
Ensembl: ENSRNOG00000014290
UniProt: P23385
Structure
PDB: 
1EWK 1ISS 1EWT 1ISR 1EWV

Position
1p13
AA seq 1199 aa
MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEFVQDEFTCRACDLGWWPNAELTGCEPIPVRYLEWSDIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGG
RQAPKGQHVWQRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEE
DNTPSAHFSPPSSPSMVVHRRGPPVATTPPLPPHLTAEETPLFLADSVIPKGLPPPLPQQ
QPQQPPPQQPPQQPKSLMDQLQGVVTNFGSGIPDFHAVLAGPGTPGNSLRSLYPPPPPPQ
HLQMLPLHLSTFQEESISPPGEDIDDDSERFKLLQEFVYEREGNTEEDELEEEEDLPTAS
KLTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL
NT seq 3600 nt   +upstreamnt  +downstreamnt
atggtccggctcctcttgattttcttcccaatgatctttttggagatgtccattttgccc
aggatgcctgacagaaaagtattgctggcaggtgcctcgtcccagcgctccgtggcgaga
atggacggagatgtcatcatcggagccctcttctcagtccatcaccagcctccagccgag
aaggtacccgaaaggaagtgtggggagatcagggaacagtatggtatccagagggtggag
gccatgttccacacgttggataagattaacgcggacccggtgctcctgcccaacatcact
ctgggcagtgagatccgggactcctgctggcactcttcagtggctctcgaacagagcatc
gaattcatcagagactccctgatttccatccgagatgagaaggatgggctgaaccgatgc
ctgcctgatggccagaccctgccccctggcaggactaagaagcctattgctggagtgatc
ggccctggctccagctctgtggccattcaagtccagaatcttctccagctgttcgacatc
ccacagatcgcctattctgccacaagcatagacctgagtgacaaaactttgtacaaatac
ttcctgagggtggtcccttctgacactttgcaggcaagggcgatgctcgacatagtcaag
cgttacaactggacctatgtctcagcagtccacacagaagggaattacggcgagagtgga
atggatgctttcaaagaactggctgcccaggaaggcctctgcatcgcacactcggacaaa
atctacagcaatgctggcgagaagagctttgaccggctcctgcgtaaactccgggagcgg
cttcccaaggccagggttgtggtctgcttctgcgagggcatgacagtgcggggcttactg
agtgccatgcgccgcctgggcgtcgtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcatcgaaggctatgaggtggaagccaacggagggatcacaata
aagcttcagtctccagaggtcaggtcatttgatgactacttcctgaagctgaggctggac
accaacacaaggaatccttggttccctgagttctggcaacatcgcttccagtgtcgccta
cctggacacctcttggaaaaccccaactttaagaaagtgtgcacaggaaatgaaagcttg
gaagaaaactatgtccaggacagcaaaatgggatttgtcatcaatgccatctatgccatg
gcacatgggctgcagaacatgcaccatgctctgtgtcccggccatgtgggcctgtgtgat
gctatgaaacccattgatggcaggaagctcctggatttcctcatcaaatcctcttttgtc
ggagtgtctggagaggaggtgtggttcgatgagaagggggatgctcccggaaggtatgac
attatgaatctgcagtacacagaagctaatcgctatgactatgtccacgtggggacctgg
catgaaggagtgctgaatattgatgattacaaaatccagatgaacaaaagcggaatggta
cgatctgtgtgcagtgagccttgcttaaagggtcagattaaggtcatacggaaaggagaa
gtgagctgctgctggatctgcacggcctgcaaagagaatgagtttgtgcaggacgagttc
acctgcagagcctgtgacctggggtggtggcccaacgcagagctcacaggctgtgagccc
attcctgtccgttatcttgagtggagtgacatagaatctatcatagccatcgccttttct
tgcctgggcatcctcgtgacgctgtttgtcaccctcatcttcgttctgtaccgggacaca
cccgtggtcaaatcctccagtagggagctctgctatatcattctggctggtattttcctc
ggctatgtgtgccctttcaccctcatcgccaaacctactaccacatcctgctacctccag
cgcctcctagttggcctctcttctgccatgtgctactctgctttagtgaccaaaaccaat
cgtattgcacgcatcctggctggcagcaagaagaagatctgcacccggaagcccagattc
atgagcgcttgggcccaagtgatcatagcctccattctgattagtgtacagctaacacta
gtggtgaccttgatcatcatggagcctcccatgcccattttgtcctacccgagtatcaag
gaagtctaccttatctgcaataccagcaacctgggtgtagtggcccctgtgggttacaat
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgccggccaac
ttcaatgaggctaaatacatcgccttcaccatgtacactacctgcatcatctggctggct
ttcgttcccatttactttgggagcaactacaagatcatcactacctgcttcgcggtgagc
ctcagtgtgacggtggccctggggtgcatgtttactccgaagatgtacatcatcattgcc
aaacctgagaggaacgtccgcagtgccttcacgacctctgatgttgtccgcatgcacgtc
ggtgatggcaaactgccgtgccgctccaacaccttcctcaacattttccggagaaagaag
cccggggcagggaatgccaattctaacggcaagtctgtgtcatggtctgaaccaggtgga
agacaggcgcccaagggacagcacgtgtggcagcgcctctctgtgcacgtgaagaccaac
gagacggcctgtaaccaaacagccgtaatcaaacccctcactaaaagttaccaaggctct
ggcaagagcctgaccttttcagatgccagcaccaagaccctttacaatgtggaagaagag
gacaataccccttctgctcacttcagccctcccagcagcccttctatggtggtgcaccga
cgcgggccacccgtggccaccacaccacctctgccaccccatctgaccgcagaagagacc
cccctgttcctggctgattccgtcatccccaagggcttgcctcctcctctcccgcagcag
cagccacagcagccgccccctcagcagcccccgcagcagcccaagtccctgatggaccag
ctgcaaggcgtagtcaccaacttcggttcggggattccagatttccatgcggtgctggca
ggcccggggacaccaggaaacagcctgcgctctctgtacccgcccccgcctccgccgcaa
cacctgcagatgctgcccctgcacctgagcaccttccaggaggagtccatctcccctcct
ggggaggacatcgatgatgacagtgagagattcaagctcctgcaggagttcgtgtacgag
cgcgaagggaacaccgaagaagatgaattggaagaggaggaggacctgcccacagccagc
aagctgacccctgaggattctcctgccctgacgcctccttctcctttccgagattccgtg
gcctctggcagctcagtgcccagttcccccgtatctgagtcggtcctctgcacccctcca
aatgtaacctacgcctctgtcattctgagggactacaagcaaagctcttccaccctgtag

DBGET integrated database retrieval system