KEGG   Rattus norvegicus (rat): 24446
Entry
24446             CDS       T01003                                 

Gene name
Hgf
Definition
(RefSeq) hepatocyte growth factor preproprotein
  KO
K05460  hepatocyte growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno05144  Malaria
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05211  Renal cell carcinoma
rno05218  Melanoma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24446 (Hgf)
   04014 Ras signaling pathway
    24446 (Hgf)
   04015 Rap1 signaling pathway
    24446 (Hgf)
   04020 Calcium signaling pathway
    24446 (Hgf)
   04151 PI3K-Akt signaling pathway
    24446 (Hgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24446 (Hgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24446 (Hgf)
   05205 Proteoglycans in cancer
    24446 (Hgf)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24446 (Hgf)
   05226 Gastric cancer
    24446 (Hgf)
   05218 Melanoma
    24446 (Hgf)
   05211 Renal cell carcinoma
    24446 (Hgf)
   05223 Non-small cell lung cancer
    24446 (Hgf)
  09174 Infectious disease: parasitic
   05144 Malaria
    24446 (Hgf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24446 (Hgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24446 (Hgf)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24446 (Hgf)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   24446 (Hgf)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   24446 (Hgf)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316
Other DBs
NCBI-GeneID: 24446
NCBI-ProteinID: NP_058713
RGD: 2794
Ensembl: ENSRNOG00000007027
UniProt: P17945
Position
4
AA seq 728 aa
MMWGTKLLPVLLLQHVLLHLLLLPVTIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLVKI
KTKKVNSADECANRCIRNKGFPFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSAVNETDVP
METTECIKGQGEGYRGTTNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLTKNYCRNPDDDAHGPWCYTGNPLVPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgatgtgggggaccaaacttctgccggtcctgttgctgcagcatgtcctgctgcacctc
ctcctgcttcctgtcaccatcccctatgcagaaggacagaagaagagaagaaatactctt
catgaattcaaaaagtcagcaaaaactactcttaccaaggaagacccattagtgaagatt
aaaaccaaaaaagtgaactctgcagatgagtgtgccaacaggtgcatcagaaacaagggc
tttccattcacttgcaaggcctttgtttttgataagtcgagaaaacgatgctactggtat
cctttcaatagtatgtcaagtggagtgaaaaaagggtttggccatgaatttgacctctat
gaaaacaaagactatattagaaattgcatcattggtaaaggaggcagctataaggggaca
gtatccatcactaagagtggcatcaagtgccagccttggaattccatgatcccccatgaa
cacagctttttgccttcgagctatcgcggtaaagacctacaggaaaactactgtcgaaat
cctcgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaa
gtctgtgacattcctcagtgttcagaagttgaatgcatgacctgcaacggtgaaagctac
agaggtcccatggatcacacagaatcaggcaagacatgtcagcgctgggatcagcagaca
ccacaccggcacaaattcttgccggaaagatatcccgacaagggctttgatgataattat
tgccgcaatcccgatggcaagccgaggccatggtgctacactcttgaccctgacacccct
tgggagtattgtgcaattaaaatgtgcgctcacagtgctgtgaatgagactgatgttccc
atggaaacaactgaatgtataaaaggccaaggagaaggttacaggggaaccaccaatacc
atttggaatggaattccgtgtcagcgttgggattcgcagtacccccacaagcatgacatc
actcccgagaacttcaaatgcaaggaccttagagaaaattattgccgcaatccggatggg
gctgaatcaccatggtgttttaccactgatccaaacatccgagttggttactgctctcaa
attcccaaatgtgacgtgtcaagtggacaagattgttatcgtggcaatgggaaaaactac
atgggcaacttatccaaaacaaggtctggactcacatgttccatgtgggacaagaatatg
gaggatttacaccgtcatatcttctgggagccagacgctagcaagttgactaagaattac
tgccggaaccccgatgacgacgcccatggaccttggtgctacacagggaatcctctcgtt
ccttgggattattgccctatttcccgttgtgaaggagatactacacctacaattgtcaat
ttggaccatcctgtaatatcctgtgccaaaacaaaacaactgcgagttgtaaatggcatt
ccaacacaaacaacagtagggtggatggttagtttgaaatacaggaataaacacatctgt
gggggatcattgataaaggaaagttgggttcttactgcaaggcaatgttttccagctaga
aacaaagacttgaaagactatgaagcttggcttggaatccatgatgtccatgagagaggc
gaggagaaacgcaaacagatcttaaacatttcccagctagtctatggacctgaaggctca
gatttggttttactgaagcttgctcgccctgcaatcctggataactttgtcagtacaatt
gatttacctagttatggctgtacaatccctgaaaagactacttgcagtatttacggctgg
ggctacactggattgatcaacgcagatggtttattacgagtagctcatctgtatattatg
gggaatgagaaatgcagtcagcaccatcaaggcaaggtgactttgaatgagtctgaatta
tgtgctggggctgaaaagattggatcaggaccttgtgagggagattatggtggcccactc
atttgtgaacaacacaaaatgagaatggttcttggtgtcattgttcctggtcgtggatgt
gccatcccaaatcgtcctggtatttttgttcgagtagcatattatgcaaaatggatacac
aaagtaattttgacatacaagttgtaa

DBGET integrated database retrieval system