KEGG   Rattus norvegicus (rat): 24499
Entry
24499             CDS       T01003                                 

Gene name
Il6r
Definition
(RefSeq) interleukin-6 receptor subunit alpha precursor
  KO
K05055  interleukin 6 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04659  Th17 cell differentiation
rno04932  Non-alcoholic fatty liver disease
rno05163  Human cytomegalovirus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24499 (Il6r)
   04066 HIF-1 signaling pathway
    24499 (Il6r)
   04151 PI3K-Akt signaling pathway
    24499 (Il6r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24499 (Il6r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    24499 (Il6r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24499 (Il6r)
   04659 Th17 cell differentiation
    24499 (Il6r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24499 (Il6r)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24499 (Il6r)
   05163 Human cytomegalovirus infection
    24499 (Il6r)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    24499 (Il6r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24499 (Il6r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    24499 (Il6r)
   04090 CD molecules [BR:rno04090]
    24499 (Il6r)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL6/12 receptor family
   24499 (Il6r)
CD molecules [BR:rno04090]
 Proteins
  24499 (Il6r)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 Ig_5 Ig_6 I-set
Other DBs
NCBI-GeneID: 24499
NCBI-ProteinID: NP_058716
RGD: 2902
Ensembl: ENSRNOG00000020811
Position
2
AA seq 462 aa
MLAVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHW
VYSGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLSCFRK
NPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVEILEG
DKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGRPRWLKVSWQDPES
WDPSYYLLQFELRYRPVWSKTFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFDIGQW
SKWSPEVTGTPWLAEPRTTPAGIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPVQGSSP
IPLPTFLVAGGSLAFGLLLCVFIILRLKKKWKSQAEKESKTTSPPPYPLGPLKPTFLLVP
LLTPSGSHNSSGTDNTGSHSCLGVRDPQCPNDNSNRDYLFPR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgctggccgtcggctgcaccctgctggtcgccctgctggccgcgcccgcagtcgcgctg
gtccttgggagctgccgcgcgctggaggtggcaaatggtacggtgacgagcctgccaggg
gccactgttaccctgatctgccctgggaaggaagcagcaggcaatgctaccattcactgg
gtgtactcaggctcacagagcagagaatggactaccacgggaaacacactggttctgagg
gccgtgcaggtcaacgacactgggcactatttgtgcttcctggatgatcatctggttggg
actgtgcccttgctggtggatgttcccccagaggagcccaagctctcctgcttccggaag
aacccccttgtaaatgccttttgtgagtggcatccaagcagcactccctctccaaccacg
aaggctgtgatgtttgcaaagaaaatcaacaccaccaatgggaagagtgacttccaggtg
ccttgccagtattctcagcagctgaaaagcttctcctgcgaggtggagatcctggagggt
gacaaagtgtaccacatagtgtcactgtgcgttgcaaacagtgtcggaagcaggtccagc
cacaatgtagtatttcagagtttaaaaatggtgcagccggatccacctgccaaccttgtg
gtatcagccatacctggaaggcctcgttggctcaaagtcagttggcaagaccctgagtcc
tgggacccaagttactacttgttgcaattcgagcttcgataccgacctgtatggtcaaag
acgttcacggtgtggccgctccaggtggcccagcatcaatgtgtcatccatgatgccttg
cgaggagtaaagcatgtggtgcaggtccgagggaaggaggagtttgacattggccagtgg
agcaaatggtccccggaggtcacaggcactccttggctagcagagcccaggaccactccg
gcagggatcccggggaaccccacacaggtctctgttgaagactatgacaaccacgaggat
cagtacggaagttctacagaagcaacgagtgtcctcgccccagtgcaaggatcctcgcct
atacccctgcccacattcctggtagctggaggaagcctggcgtttggattgcttctctgt
gtcttcatcatcttgagactcaagaagaaatggaagtcacaggctgagaaggaaagcaag
acgacttctcccccaccgtatcccttgggaccgctgaagccgaccttcctcctggttcct
ctcctcaccccatcagggtcccataacagctctgggactgacaacaccggaagccacagc
tgcctgggtgtcagggacccacagtgccctaatgacaacagcaacagagactacttattc
cccagataa

DBGET integrated database retrieval system