KEGG   Rattus norvegicus (rat): 24530
Entry
24530             CDS       T01003                                 

Gene name
Lcat
Definition
(RefSeq) lecithin cholesterol acyltransferase
  KO
K00650  lecithin-cholesterol acyltransferase [EC:2.3.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    24530 (Lcat)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    24530 (Lcat)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.43  phosphatidylcholine---sterol O-acyltransferase
     24530 (Lcat)
SSDB
Motif
Pfam: LCAT Abhydrolase_6 Hydrolase_4 Ser_hydrolase Abhydrolase_1 Esterase DUF1749 PGAP1
Other DBs
NCBI-GeneID: 24530
NCBI-ProteinID: NP_058720
RGD: 2993
Ensembl: ENSRNOG00000019573
UniProt: P18424
Position
19q12
AA seq 440 aa
MGLPGSPWQWVLLLLGLLLPPATSFWLLNVLFPPHTTPKAELSNHTRPVILVPGCMGNRL
EAKLDKPNVVNWLCYRKTEDFFTIWLDFNMFLPLGVDCWIDNTRVVYNRSSGHMSNAPGV
QIRVPGFGKTYSVEYLDDNKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLAPRQQDEY
YQKLAGLVEEMYAAYGKPVFLIGHSLGCLHVLHFLLRQPQSWKDHFIDGFISLGAPWGGS
IKPMRILASGDNQGIPIMSNIKLREEQRITTTSPWMFPAHHVWPEDHVFISTPNFNYTGQ
DFERFFADLHFEEGWHMFLQSRDLLAGLPAPGVEVYCLYGVGMPTAHTYIYDHNFPYKDP
VAALYEDGDDTVATRSTELCGQWQGRQSQAVHLLPMNGTDHLNMVFSNKTLEHINAILLG
AYRHGTPKSPTASLGPPTKE
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggggctgcctggctccccttggcagtgggtgctgttgctgttggggctactgctccct
cctgccacctccttctggctcctcaatgtgctcttccccccgcacaccacgcccaaggct
gaactcagtaaccacacacggcctgtcatcctcgtgcctggctgcatggggaaccggcta
gaagccaagctggataaaccaaatgtggtaaactggctgtgctaccgaaagacagaggac
ttttttaccatctggctggatttcaacatgtttctacccctcggggtggactgctggatt
gataacaccagggttgtctacaaccgaagctctgggcacatgtccaatgcccctggtgta
cagatccgtgtccctggctttggcaagacctactctgttgaatacttggatgacaacaag
ctagcaggctacctgcacacactggtgcagaatctggttaacaatgggtatgtgcgggat
gagacagtgcgggctgcaccctatgactggcgtctggcaccccgccagcaggatgaatac
taccagaagctggcaggactggtagaggagatgtatgctgcttacgggaagcctgttttc
cttattggacacagccttggctgcctacatgtgctccatttcttactgcgtcagccacag
tcctggaaggaccacttcattgatggcttcatctctcttggggccccatggggcggttcc
atcaagcccatgcggatcctggcctcaggtgacaaccagggcatcccgatcatgtccaac
ataaagctgagagaagaacagcgcataaccacaacttccccctggatgtttccagctcac
cacgtgtggcctgaagaccacgtgttcatttccacaccaaacttcaactacacaggccaa
gacttcgagcgtttttttgcagatcttcattttgaagaaggctggcacatgtttctacag
tctcgtgacctactagcaggcctcccagcgcctggtgtagaagtatattgtctatacggt
gtaggcatgcccacagcccacacctacatctatgaccacaactttccctacaaagacccg
gtggctgcactctatgaagatggggacgacactgtagccacacgtagcactgagctctgt
ggccagtggcagggccgccagtcacaggctgtacacttgctgcccatgaatgggacagat
catctcaacatggtcttcagcaataagacactggagcatattaatgctatcctactgggt
gcctaccgccatggcactcctaagtccccaaccgccagcctaggtccccccaccaaggaa
taa

DBGET integrated database retrieval system