KEGG   Rattus norvegicus (rat): 24598Help
Entry
24598             CDS       T01003                                 

Gene name
Nos1, bNOS
Definition
(RefSeq) nitric oxide synthase 1
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04145  Phagosome
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04730  Long-term depression
rno04926  Relaxin signaling pathway
rno04970  Salivary secretion
rno05010  Alzheimer's disease
rno05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    24598 (Nos1)
   00330 Arginine and proline metabolism
    24598 (Nos1)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    24598 (Nos1)
   04020 Calcium signaling pathway
    24598 (Nos1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    24598 (Nos1)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    24598 (Nos1)
  Digestive system
   04970 Salivary secretion
    24598 (Nos1)
  Nervous system
   04730 Long-term depression
    24598 (Nos1)
  Environmental adaptation
   04713 Circadian entrainment
    24598 (Nos1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    24598 (Nos1)
   05014 Amyotrophic lateral sclerosis (ALS)
    24598 (Nos1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     24598 (Nos1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_2 Flavodoxin_5
Motif
Other DBs
NCBI-GeneID: 24598
NCBI-ProteinID: NP_434686
RGD: 3184
Ensembl: ENSRNOG00000001130
UniProt: P29476
Structure
PDB: 
1QAU 4FVY 3N5W 5VUN 1OM4 4D7O 4CTV 3N66 1P6K 5VUO 5FW0 4UH1 4D3B 4CX5 4GQE 3N5X 3N65 3JT4 4FVW 3NM0 5UNY 4CTX 5FVT 4CAM 5FVR 5AGM 3RQJ 5G0O 4KCN 4K5G 3NLM 2G6M 4LUX 4KCO 3NLX 3PNG 4D2Z 4K5E 3UFU 5UNS 5AD5 5AD8 5AGO 4UPM 4CX6 4CTW 3TYL 3N2R 2G6I 2G6N 1ZZQ 1ZZU 1P6I 1F20 1QAV 4UPP 4CAN 3HSN 4JSJ 3NLZ 4KCL 3TYO 3RQL 3JWU 5VUP 5G0N 5AGL 4JSG 3PNF 5VUJ 5VUK 5VUS 5UNR 5UNZ 5FVQ 5FVS 5AD7 4UH4 5AGN 4D31 4UPO 4CAQ 4FW0 3RQM 3RQN 3N61 3N62 3N64 3JWS 3JX3 3JT8 3B3M 1RS6 1RS7 5VUU 4D30 4V3Y 5VUR 5UO0 4CX3 4JSE 3UFS 3TYN 3PNE 3NNZ 5AD4 5ADA 4D2Y 4CX4 4CAO 4C39 3N60 3JWV 3B3N 1P6H 4UH2 4V3X 4FVZ 3NLY 5VUL 5VUQ 5VUT 5UNV 5AD6 5AGK 4CTQ 4CDT 4FVX 3UFW 3TYM 3NLN 3N63 3JX1 2HX3 2G6H 2G6K 1ZVI 1VAG 1P6J 1MMV 1MMW 1LZX 3JWT 3NLK 3NLP 3HSO 5UNX 4UH3 4IMU 5UNW 4UH0 5UNT 5UNU 5ADB 4V3Z 4CTP 4KCJ 4JSF 3SVP 3N5Y 3B3O 2G6L 1ZZR 1LZZ 1M00 5VUI 4V3V 4CAP 3UFQ 4KCM 4UGZ 3UFT 3UFV 4UPN 4JSI 5VUM 5G0P 5FVP 5ADC 5ADD 5ADE 5AGP 4D32 4KCK 4K5D 3UFP 3UFR 3NNY 3NLR 3NLV 3NLW 3JX2 3JT5 3JT7 3JT9 1QW6 4V3W 4EUX 4KCH 4IMS 3Q99 3NLQ 3JX5 3JT3 2HX4 1K2R 4CTU 3UFO 3SVQ 3N5Z 3JTA 4CTR 4K5F 4IMT 4IMW 3NLJ 3JX0 3JT6 3HSP 1K2T 1K2U 3RQK 3Q9A 3JX4 4KCI 4HOP 5AD9 4CTT 3NLO 3N5V 2G6J 1TLL 1QWC 1OM5 4JSH 3JX6 3DQR 3B3P 1ZVL 1K2S 3FC5 1B8Q
Thumbnails

Position
12q16
AA seq 1463 aa AA seqDB search
MEENTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPSASKDQSLAVDRVTGLGNGPQHAQGHGQGAGSVSQANGVAI
DPTMKSTKANLQDIGEHDELLKEIEPVLSILNSGSKATNRGGPAKAEMKDTGIQVDRDLD
GKSHKAPPLGGDNDRVFNDLWGKDNVPVVLNNPYSEKEQSPTSGKQSPTKNGSPSRCPRF
LKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRTKDQLFPLAKE
FLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQ
WSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLI
RYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPEL
VLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCD
NSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIK
HMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTN
GTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHA
FDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKY
PEPLRFFPRKGPSLSHVDSEAHSLVAARDSQHRSYKVRFNSVSSYSDSRKSSGDGPDLRD
NFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEA
FRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPDLTQGLSN
VHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNA
LIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTP
LQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQ
LSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPC
FVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQS
KIDHIYREETLQAKNKGVFRELYTVYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHI
YVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTN
RLRSESIAFIEESKKDADEVFSS
NT seq 4392 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaacacgtttggggttcagcagatccaacccaatgtaatttctgttcgtctc
ttcaaacgcaaagtgggaggtctgggcttcctggtgaaggaacgggtcagcaagcctccc
gtgatcatctcagacctgattcgaggaggtgctgcggagcagagcggccttatccaagct
ggagacatcattctcgcagtcaacgatcggcccttggtagacctcagctatgacagtgcc
ctggaggttctcaggggcattgcctctgagacccacgtggtcctcattctgaggggccct
gagggcttcactacacatctggagaccaccttcacaggggatggaacccccaagaccatc
cgggtgacccagcccctcggtcctcccaccaaagccgtcgatctgtctcaccagccttca
gccagcaaagaccagtcattagcagtagacagagtcacaggtctgggtaatggccctcag
catgcccaaggccatgggcagggagctggctcagtctcccaagctaatggtgtggccatt
gaccccacgatgaaaagcaccaaggccaacctccaggacatcggggaacatgatgaactg
ctcaaagagatagaacctgtgctgagcatcctcaacagtgggagcaaagccaccaacaga
gggggaccagccaaagcagagatgaaagacacaggaatccaggtggacagagacctcgat
ggcaaatcgcacaaagctccgcccctgggcggggacaatgaccgcgtcttcaatgacctg
tgggggaaggacaacgttcctgtggtccttaacaacccgtattcagagaaggaacagtcc
cctacctcggggaaacagtctcccaccaagaacggcagcccttccaggtgcccccgtttc
ctcaaggtcaagaactgggagacggacgtggtcctcaccgacaccctgcacctgaagagc
acactggaaacggggtgcacagagcacatttgcatgggctcgatcatgctgccttcccag
cacacgcggaagccagaagatgtccgcacaaaggaccagctcttccctctagccaaagaa
tttctcgaccaatactactcatccattaagagatttggctccaaggcccacatggacagg
ctggaggaggtgaacaaggagattgaaagcaccagcacctaccagctcaaggacaccgag
ctcatctatggcgccaagcatgcctggcggaacgcctctcgatgtgtgggcaggatccag
tggtccaagctgcaggtgttcgatgcccgagactgcaccacagcccacggcatgttcaac
tacatctgtaaccatgtcaagtatgccaccaacaaagggaatctcaggtcggccatcacg
atattccctcagaggactgacggcaaacatgacttccgagtgtggaactcgcagctcatc
cgctacgcgggctacaagcagccagatggctctaccttgggggatccagccaatgtgcag
ttcacggagatctgtatacagcagggctggaaagccccaagaggccgcttcgacgtgctg
cctctcctgcttcaggccaatggcaatgaccctgagctcttccagatccccccagagctg
gtgctggaagtgcccatcaggcaccccaagttcgactggtttaaggacctggggctcaaa
tggtatggcctccccgctgtgtccaacatgctgctggagatcgggggcctggagttcagc
gcctgtcccttcagcggctggtacatgggcacagagatcggcgtccgtgactactgtgac
aactctcgatacaacatcctggaggaagtagccaagaagatggatttggacatgaggaag
acctcgtccctctggaaggaccaagcactggtggagatcaacattgctgttctatatagc
ttccagagtgacaaggtgaccatcgttgaccaccactctgccacggagtccttcatcaaa
cacatggagaatgaataccgctgcagagggggctgccccgccgactgggtgtggattgtg
cctcccatgtcgggcagcatcacccctgtcttccaccaggagatgctcaactatagactc
accccgtcctttgaataccagcctgatccatggaacacccacgtgtggaagggcaccaac
gggacccccacgaagcggcgagctatcggctttaagaaattggcagaggccgtcaagttc
tcagccaagctaatggggcaggccatggccaagagggtcaaggcgaccattctctacgcc
acagagacaggcaaatcacaagcctatgccaagaccctgtgtgagatcttcaagcacgcc
ttcgatgccaaggcaatgtccatggaggagtatgacatcgtgcacctggagcacgaagcc
ctggtcttggtggtcaccagcacctttggcaatggagacccccctgagaacggggagaaa
ttcggctgtgctttaatggagatgaggcaccccaactctgtgcaggaggagagaaagtac
ccggaacccttgcgtttctttccccgtaaagggccttccctctcccatgttgactctgaa
gcccacagtctggttgctgcccgtgacagccaacacaggagctacaaggtccgattcaac
agcgtctcctcctattctgactcccgaaagtcatcgggcgacggacccgacctcagagac
aactttgaaagtactggacccctggccaatgtgaggttctcagtgttcggcctcggctct
cgggcgtacccccacttctgtgcctttgggcatgcggtggacaccctcctggaggaactg
ggaggggagaggattctgaagatgagggagggggatgagctttgcggacaggaagaagct
ttcaggacctgggccaagaaagtcttcaaggcagcctgtgatgtgttctgcgtgggggat
gacgtcaacatcgagaaggcgaacaactccctcattagcaatgaccgaagctggaagagg
aacaagttccgcctcacgtatgtggcggaagctccagatctgacccaaggtctttccaat
gttcacaaaaaacgagtctcggctgctcgactcctcagccgccaaaacctgcaaagccct
aagtccagccgatcgaccatcttcgtgcgtctccacaccaacgggaatcaggagctgcag
taccagccaggggaccacctgggtgtcttccccggcaaccacgaggacctcgtgaatgca
ctcattgaacggctggaggatgcaccgcctgccaaccacgtggtgaaggtggagatgctg
gaggagaggaacactgctctgggtgtcatcagtaattggaaggatgaatctcgcctccca
ccctgcaccatcttccaggccttcaagtactacctggacatcaccacgccgcccacgccc
ctgcagctgcagcagttcgcctctctggccactaatgagaaagagaagcagcggttgctg
gtcctcagcaaggggctccaggaatatgaggagtggaagtggggcaagaaccccacaatg
gtggaggtgctggaggagttcccgtccatccagatgccggctacacttctcctcactcag
ctgtcgctgctgcagcctcgctactactccatcagctcctctccagacatgtaccccgac
gaggtgcacctcactgtggccatcgtctcctaccacacccgagacggagaaggaccagtc
caccacggggtgtgctcctcctggctcaacagaatacaggctgacgatgtagtcccctgc
ttcgtgagaggtgcccctagcttccacctgcctcgaaacccccaggtgccttgcatcctg
gttggcccaggcactggcatcgcacccttccgaagcttctggcaacagcgacaatttgac
atccaacacaaaggaatgaatccgtgccccatggttctggtcttcgggtgtcgacaatcc
aagatagatcatatctacagagaggagaccctgcaggccaagaacaagggcgtcttcaga
gagctgtacactgtctattcccgggaaccggacaggccaaagaaatatgtacaggacgtg
ctgcaggaacagctggctgagtctgtgtaccgcgccctgaaggagcaaggaggccacatt
tatgtctgtggggacgttaccatggccgccgatgtcctcaaagccatccagcgcataatg
acccagcaggggaaactctcagaggaggacgctggtgtattcatcagcaggctgagggat
gacaaccggtaccacgaggacatctttggagtcaccctcagaacgtatgaagtgaccaac
cgccttagatctgagtccatcgccttcatcgaagagagcaaaaaagacgcagatgaggtt
ttcagctcctaa

DBGET integrated database retrieval system