KEGG   Rattus norvegicus (rat): 245983
Entry
245983            CDS       T01003                                 

Gene name
Il11ra1
Definition
(RefSeq) interleukin 11 receptor subunit alpha 1
  KO
K05056  interleukin 11 receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    245983 (Il11ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    245983 (Il11ra1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    245983 (Il11ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    245983 (Il11ra1)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL6/12 receptor family
   245983 (Il11ra1)
SSDB
Motif
Pfam: Ig_3 ig EpoR_lig-bind Ig_2
Other DBs
NCBI-GeneID: 245983
NCBI-ProteinID: NP_620816
RGD: 621332
Ensembl: ENSRNOG00000015068
UniProt: Q99MF4
Position
5q22
AA seq 431 aa
MSSSRSGLTRVLVAVATALVSSSTPCPQAWGPPGVQYGQPGRPVMLCCPGVNAGTPVSWF
RDGDSRLLQGPDSGLGHRLVLAQVDSRDEGTYVCRTLDGVFGGMVTLKLGSPPARPEVSC
QAVDYENFSCTWSPGRVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRC
VVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQRILRPDPPQGLRVESVPGYPRRLHASW
TYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEELITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSTGPLRDEVPDGSRGHEQKLEAAAQEDSPAPPSPSLQPDPRPLDH
RDPLEQVAVLASLGIFSFLGLAVGALALGLWLRLRRSGKDGPQKPGFLAPMIPGDKLPGI
PNLQRTPENFS
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagcagcagccgctcagggctgaccagggtcctggtggccgtggctacagccctggtg
tcttcctccaccccctgcccccaagcttggggtcctccaggggtccagtatgggcagcct
ggcaggcccgtgatgctgtgctgccccggagtgaatgctgggactccggtgtcctggttt
cgggatggggactcgaggctgctccagggacctgactctggactaggacacagactggtc
ttggcccaggtggacagccgtgacgagggcacttacgtctgtcggacgctggatggtgta
tttgggggcatggtgaccctgaagctgggctcccccccagctcggccggaggtctcctgc
caagcagtagactatgaaaacttttcttgtacttggagtccaggccgggtcagcggtttg
cccacccgctaccttacttcctacaggaagaagaccctgccaggagctgagagtcagagg
gagagtccgtctaccgggccttggccatgcccacaagaccccctggaggcttcccgatgt
gtggtccacggggcagagttctggagtgaataccggatcaatgtgactgaggtgaaccca
ctgggcgccagcacgtgcctactggatgtgagattacagaggatcttacgtcctgatcca
ccccaagggctgcgggtggaatcagtacctggctacccgagacgcctgcatgccagctgg
acataccctgcctcctggcgtcgccagccccacttcctgctcaagttccggttgcaatac
cgtccagcacagcatccagcctggtccacggtggagcccattggcttggaggagttgata
acagatgccgtggctgggctgccccatgcggtacgagtcagcgccagggactttctggat
gctggcacctggagtgcttggagcccagaggcctggggtactcctagcaccggtcccctg
cgggatgaggtacctgatgggagccggggacacgaacagaagctagaggcagcagctcag
gaggacagccccgctcctccaagcccttccttgcagccagacccaaggccacttgatcac
agggaccccttggagcaagtggctgtgttagcatctctgggaatcttctctttccttggc
ctggctgttggagccctggctctggggctctggctgaggctgaggcggagtgggaaggac
gggcctcaaaagcctggcttcttggcaccaatgatcccaggggacaagcttccaggaatc
ccaaacctgcagaggaccccagagaacttcagctga

DBGET integrated database retrieval system