KEGG   Rattus norvegicus (rat): 24600Help
Entry
24600             CDS       T01003                                 

Gene name
Nos3, eNos
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04066  HIF-1 signaling pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04611  Platelet activation
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    24600 (Nos3)
   00330 Arginine and proline metabolism
    24600 (Nos3)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    24600 (Nos3)
   04371 Apelin signaling pathway
    24600 (Nos3)
   04066 HIF-1 signaling pathway
    24600 (Nos3)
   04020 Calcium signaling pathway
    24600 (Nos3)
   04071 Sphingolipid signaling pathway
    24600 (Nos3)
   04022 cGMP - PKG signaling pathway
    24600 (Nos3)
   04151 PI3K-Akt signaling pathway
    24600 (Nos3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    24600 (Nos3)
  Endocrine system
   04915 Estrogen signaling pathway
    24600 (Nos3)
   04921 Oxytocin signaling pathway
    24600 (Nos3)
   04926 Relaxin signaling pathway
    24600 (Nos3)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    24600 (Nos3)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    24600 (Nos3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24600 (Nos3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     24600 (Nos3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Motif
Other DBs
NCBI-GeneID: 24600
NCBI-ProteinID: NP_068610
RGD: 3186
Ensembl: ENSRNOG00000009348
UniProt: Q62600
Position
4q11
AA seq 1202 aa AA seqDB search
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSQAPVPPSPTRPAPDHSPPLTR
PPDGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPTQGPSPTE
QLLGQARDFINQYYNSIKRSGSQAHEQRLQEVEAEVVATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCRTAQEMFTYICNHIKYATNRGNLRSAITVFPQRYAGRGDF
RIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFTLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSSE
IGMRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLYSYQLAKVTIVDHH
AATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWK
GSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAESLQLLPGLTHVHRRKMFQATILSVENLQSSKSTRATILV
RLDTGSQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPSTEPVAVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTYFLDITSPPSPRLLRLLSTLAEESSEQQELEALSQDPRRYE
EWKWFRCPTLLEVLEQFPSVALPAPLILTQLPLLQPRYYSVSSAPSAHPGEIHLTVAVLA
YRTQDVLGPLHYGVCSTWMSQLKAGDPVPCFIRGAPSFRLPPDPNLPCILVGPGTGIAPF
RGFWQDRLHDIEIKGLQPAPMTLVFGCRCSQLDHLYRDEVLDAQQRGVFGQVLTAFSRDP
GSPKTYVQDLLRTELAAEVHRVLCLEQGHMFVCGDVTMATSVLQTVQRILATEGSMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWSFDPPTQETP
GS
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcctgggccaccctgtggcctagggctcggg
ctgggcctagggctatgcggcaagcagggcccagcctcaccggcaccagagcctagccag
gcaccagtacccccgtccccaacccgaccagcaccagaccacagccccccgttaacccgg
cccccagacggacccaagtttcctcgagtaaagaactgggaagtgggcagcatcacctac
gataccctcagtgcacaggctcagcaggatgggccctgtaccccaagacgctgcttggga
tccctggtatttccaaggaagttacagagccggcccacccagggcccttcacccactgag
cagctattgggtcaagcccgggacttcatcaatcagtactataactcgatcaaaaggagt
ggttcccaggctcatgagcagcggcttcaggaagtggaagctgaggtggtggccacgggc
acctaccagctccgggagagtgagctggtgtttggggccaaacaggcctggcgcaacgct
ccccgctgtgtggggcggatccagtgggggaaactgcaggtatttgatgctcgggactgc
aggacagcacaggaaatgttcacctacatctgtaaccacattaagtatgcaacaaaccga
ggcaatcttcgttcagccatcacggtgttcccccagcgctacgctggccggggagacttc
cggatctggaacagccagctggtgcgctacgcgggctataggcagcaggacggctctgtg
cgaggggaccctgccaacgtggagatcactgagctctgtattcaacatggctggacccca
ggaaatggccgctttgatgtgctgcccctgctactccaggctcccgatgagcccccagaa
ctcttcactctgcccccagagctggtcctcgaggtgcctctggagcaccccacgctagag
tggtttgctgcccttggcctgcgctggtatgccctcccagctgtgtccaatatgctgcta
gaaatcgggggcctggagtttccggctgcccctttcagcggctggtacatgagttcagag
attggcatgagggacctgtgtgaccctcaccgatacaacatacttgaggatgtggctgtc
tgcatggatctagacacccggacaacctcatcactgtggaaagacaaggcagcagtggaa
attaacgtggctgtgctgtacagttaccagctggccaaagtgaccattgtggaccaccat
gccgccacagcctccttcatgaagcacttggaaaatgagcagaaggccagagggggctgc
cccgctgactgggcctggatcgtgccccccatctcaggcagcctcacccctgtcttccat
caagagatggtcaactatttcctgtcccctgccttccgctaccagcctgacccctggaaa
ggaagtgcagcaaaaggcacaggcatcaccaggaagaagacttttaaggaagtagccaat
gcagtgaagatctctgcctcactcatgggcacggtgatggcgaagcgtgtgaaggcgact
atcctgtatggctctgagactggccgcgcccagagctacgcacagcagctggggaggctc
tttcggaaggcgtttgacccccgggtcctgtgcatggatgaatacgatgtggtatcccta
gagcatgaggccttggtattggtggtgaccagcacatttggcaatggggatcccccggag
aatggagagagctttgcagcagcgctgatggaaatgtcgggcccctacaacagctcccct
cggcctgagcagcacaagagttacaaaatccgattcaacagtgtctcctgctcggaccca
ctggtatcctcttggcggcgcaaaaggaaggaatccagtaacacagacagtgcaggggcc
ctgggcaccctcaggttctgtgtgtttgggctgggctccagagcatacccgcacttctgt
gcctttgctcgagcggtggacacaaggctggaggagctgggcggggagcgactgttgcag
ctgggccagggtgatgagctctgcggccaggaggaggctttccgaggctgggcccaggca
gccttccaggctgcctgtgaaactttctgtgtgggagaagatgccaaggctgctgcccga
gatatcttcagtcccaagcgcagctggaaacgccagaggtaccggctgagtacccaagct
gagagcctgcaattactgccagggctgactcacgtgcacagacggaagatgttccaggct
acaattctttctgtggagaacctacagagcagcaaatccacccgagccacaatcctggtg
cgtctggacactggaagccaggagggactgcagtaccagccaggggaccacataggtgtg
tgcccacccaaccggcctggcctagtggaggcgctgctgagccgagtggaggaccctccg
ccatccacagagcctgtggccgtggaacaactggaaaaaggcagccctggtggccctccc
cccggctgggtacgggacccccggcttcccccatgtacgctgcgccaggctctcacttac
ttcctggacatcacttccccgcccagccctcgccttcttcgactgctgagcaccctggca
gaggagtccagcgaacagcaggagctagaggctcttagccaggacccccggcgctacgaa
gaatggaagtggttccgctgccccacactgctagaggtgctggaacaatttccatccgtg
gcactgcctgccccgctgatcctcacccagctgcccctgctccagccccggtactactct
gtcagctcagcacccagcgcccacccaggagagatccacctcactgtagctgtgctggca
tacagaacccaggatgtgctgggccctctgcactatggggtctgttccacatggatgagc
caactcaaggcaggagacccggtgccctgcttcatcaggggggctccctccttccggctg
ccacctgatcctaacttgccttgcatcctggtgggcccagggactggtattgcacccttc
cggggattctggcaagaccgattacacgacattgagatcaaaggactgcagcctgccccc
atgactttggtgtttggctgccgatgctcccaactggaccatctctaccgggacgaggta
ctggacgcccagcagcgtggagtgtttggacaagtcctcaccgccttttccagggatcct
ggcagccctaagacctatgtgcaagacctcctgaggacagagctggccgcggaggttcac
cgcgtgctgtgcctcgagcaaggacacatgtttgtctgcggtgatgtcactatggcaacc
agcgtcctgcaaaccgtgcagcgaattctggcaacagagggcagcatggagctggatgaa
gccggtgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaggacattttcgga
ctcacattgcgcacccaggaggtgacgagccgcatccgcacccagagtttttctttgcag
gagcgacagctgaggggtgcagtgccctggtcctttgacccgcctacccaagaaacacct
ggttcctga

DBGET integrated database retrieval system