KEGG   Rattus norvegicus (rat): 246264
Entry
246264            CDS       T01003                                 

Gene name
Zfp382, Ks1, Znf382
Definition
(RefSeq) zinc finger protein 382
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    246264 (Zfp382)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    246264 (Zfp382)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    246264 (Zfp382)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 DUF3268 zf-Di19 C1_4 zinc_ribbon_15 zf-C2HC_2 Zn_Tnp_IS1595 zf-LYAR zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 246264
NCBI-ProteinID: NP_653350
RGD: 708385
Ensembl: ENSRNOG00000020777
UniProt: A0JPL0 A0A0G2JSS4
Position
1q21
AA seq 566 aa
MNCHSVPLQGPVSFKDVTVDFTQEEWQRLDPAQKALYRDVMLENYCHFISVGFHITKPDM
IRKLEQGEELWTERMFPSQSYLEDEEVLVKFRDYQDKPPTSIVIINHKKLIKERNNVYEK
TLGNNHIISKTLFEYKSDGKVLKNISDFISRDINPVMGTLGDSSEWEESVLTSEQEKTHP
VPTLYKQIGRNLSSSLELAQHQKTQIPEQRFECDECDSSFLMTEVAFPHDRAHRGVRDFN
CSKDEIAFFEKSDLGIHPHNLMEKKCSTYNKYGKLLCRKSVFVMHPRSQVDERPFQCPYC
GNSFRRKSYLIEHQRIHTGEKPYICSQCGKAFRQKTALTLHEKTHTDGKPYLCVDCGKSF
RQKATLTRHHKTHTGEKAYECTQCGSAFGKKSYLIDHQRTHTGEKPYQCAECGKAFIQKT
TLTVHQRTHTGEKPYMCSECGKSFCQKTTLTLHQRIHTGEKPYVCSDCGKSFRQKAILTV
HYRIHTGEKSNGCPQCGKAFSRKSNLIRHQKTHTGEKPYECHECGKFFSCKSNLVAHQKT
HKAETVRFQRKMELKRAINEVEGTGR
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgaactgccacagtgtgcccttacagggaccagtgtcattcaaggacgtgactgtggac
ttcacccaggaggagtggcagcgattggaccctgcccagaaggccctctacagggacgtg
atgctggaaaactactgtcatttcatctcggtgggatttcacataacaaaacctgacatg
atccgcaagttggagcaaggagaggagctgtggacagagcgaatgttcccaagtcagagc
tatctggaagatgaagaggttttggtgaagttcagagactaccaagacaagcctcctaca
tcaattgtgatcatcaaccacaagaagctaattaaggagaggaacaatgtttatgagaaa
acactaggcaataaccatattatttccaaaacactgtttgagtataaatctgatgggaaa
gttttgaaaaacatctcagacttcatcagtagagatataaaccctgtaatggggacgctg
ggtgacagcagtgagtgggaggaatcagtcctgacttcagagcaggagaaaactcatcct
gtcccaactctctataaacaaatcggaaggaatctgagctccagcctggagctcgctcag
caccagaagacccagattccggagcagaggtttgaatgtgatgaatgtgacagctccttc
ctcatgacagaagtggcatttccacatgacagagctcacagaggggtcagggacttcaac
tgcagtaaagatgaaattgctttttttgagaagtcagaccttggtattcacccacataat
cttatggaaaagaaatgttctacatacaacaaatatgggaaactcctttgcagaaagtca
gtttttgttatgcaccccagatctcaggtggacgagaggcccttccagtgtccttactgt
gggaacagttttagaaggaagtcctaccttatcgagcatcagaggatccacacaggtgag
aagccctatatttgcagtcagtgcgggaaagctttccgtcagaagacggctctgacgctc
catgaaaaaacacacacagacgggaagccctacctctgtgtggactgtgggaagtccttc
cgccagaaggccaccctcaccaggcaccacaaaacgcacacgggggagaaagcctacgaa
tgcactcagtgtggaagtgcctttggaaaaaagtcctacctcatcgaccatcagaggact
cacacaggggagaaaccctatcagtgcgctgagtgtgggaaggcgtttatccagaagaca
acgctcacagtgcaccagaggactcacacaggggagaagccctacatgtgcagcgagtgt
gggaagtccttctgccagaagacgaccctgaccctccatcagcggatccacactggcgag
aagccctacgtctgcagtgactgtgggaagtccttccgccagaaggctatcctcactgtg
cactacagaatacacacaggggaaaagtccaacggctgtccccagtgtggtaaagccttc
agtaggaagtcaaacctcatccgccaccagaaaactcacacgggagaaaaaccctatgaa
tgtcatgagtgtggaaaattctttagttgtaaatcgaacctcgtcgcccaccagaaaact
cacaaggcagagacggtgagatttcaaagaaaaatggaactcaagagagctattaatgaa
gttgaaggaacaggaagatag

DBGET integrated database retrieval system