KEGG   Rattus norvegicus (rat): 246294
Entry
246294            CDS       T01003                                 

Gene name
Optn
Definition
(RefSeq) optineurin
  KO
K19946  optineurin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    246294 (Optn)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    246294 (Optn)
   05022 Pathways of neurodegeneration - multiple diseases
    246294 (Optn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    246294 (Optn)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    246294 (Optn)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    246294 (Optn)
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    246294 (Optn)
  Xenophagy
   Cargo receptors
    246294 (Optn)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 CMD Baculo_PEP_C
Other DBs
NCBI-GeneID: 246294
NCBI-ProteinID: NP_659549
RGD: 628886
Ensembl: ENSRNOG00000017941
UniProt: Q8R5M4
Position
17
AA seq 585 aa
MSHQPLSCLTEKGDSSCETPGNGPSNMVHPNLDTFTPEELLQQMKELLVENHQLKEAMKL
NNQAMKGRFEELSAWTEKQKEERQLFEIQSKEAKERLKALSHENERLKEELGKLKEKSER
PFEDITGRCGFPRTDLEQEVEQLKRQVEQEVEHLKNQVRRLQAEKADLLGIVSELQLKLN
SSGSSEDSFVEIRMTEGEAEGAMKEMRNSAGPTRTDSISMGKCTEDARTCVEFEELTVSQ
LLLCLREGNQKVERLEIALREAKERISDFEKKANGHSAIETQTEGSTQKEEEDKDPESVG
IEVETLNVQVASLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSELNEKQELVY
SNRKLELQVESMRSEIKMEQAKTEEEKSRLATLQATHDKLLQEHNKALRTIEELTKQQAE
KVDKVQLQELSEKLELAEQALASKQLQMDEMKQTIAKQEEDLETMAVLRAQMEVYCSDFH
AERAAREKIHEEKEQLALQLAILLKENNDFEDGGSRQSLMEMQCRHGARTSDSDQQAYLF
QRGAEDMSWQHGQQPRSIPIHSCPKCGEVLPDIDTLQIHVMDCII
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgtcccatcaacctctgagctgcctgactgagaagggggacagctcctgtgagacccca
ggaaatggaccctccaatatggttcaccccaacctggacacattcactcctgaggagctg
ctgcagcaaatgaaagaactcctggtcgagaaccaccagctgaaagaagccatgaagcta
aataatcaagctatgaaagggcgatttgaggagctttctgcctggacagagaagcagaag
gaagaacgccagttgtttgagatacaaagcaaagaggctaaggagcgcctcaaggccctg
agtcatgaaaatgagaggctgaaggaagagcttggaaaactaaaagagaaatcagaaagg
ccatttgaagacatcacaggtagatgcgggtttcccagaaccgacttggagcaggaagtg
gagcaactgaagaggcaggtggagcaggaagtggagcatctgaagaaccaggtgaggcgc
cttcaggctgagaaagcggacctgctgggcatcgtctcagaactgcagctcaagctcaac
tccagcggctcctcagaagactccttcgtggagatcaggatgactgaaggagaggcggaa
ggggcaatgaaggagatgaggaacagcgctggacccacaaggacagactccatcagcatg
ggcaaatgtacagaggacgccaggacttgtgtggagtttgaggaactgactgtgagccaa
ctcctgctttgcctcagggaaggaaaccaaaaggtggagagactcgagatcgcgctcaga
gaagccaaagaaagaatttcagattttgaaaagaaagcaaacggccattctgcgattgag
acccagacagaggggagcacacaaaaagaagaggaggacaaagacccagagagtgtggga
atcgaagtggaaactctgaatgttcaagtggcctctctgtttaaggagcttcaagaggcg
cacacaaagctcagtgaggccgagctgatgaagaagagacttcaagaaaagtgtcaggct
ctggaaaggaagaactctgcaaccccatcggagctgaatgaaaagcaagagctcgtttac
agtaacaggaagttagagctgcaggtggagagcatgcgctcggaaatcaagatggagcag
gccaagacagaggaggagaaatccaggttagccactcttcaggcaacacacgacaagctt
cttcaggaacacaataaagctctgagaacaattgaagaactaaccaaacaacaggcagaa
aaagtggacaaggtgcagctgcaggagctcagcgagaagctggagctggcggagcaggct
ctggcgtccaagcagctccagatggatgagatgaagcagaccatcgccaagcaggaggag
gacctggagaccatggccgtcctcagggctcagatggaggtgtactgttcagatttccat
gctgagagggcagcaagggagaagatccatgaggaaaaggagcagctggccttgcagctc
gccattttgctgaaagagaacaatgactttgaagatggaggcagtaggcagtccttgatg
gaaatgcagtgccggcatggggcgagaaccagcgactctgaccagcaggcttacctgttt
caaagaggagccgaggacatgagctggcagcatgggcagcagccccggagtattcccatt
cactcgtgccccaagtgtggggaggtcctgccggacattgacacgcttcagatacatgtg
atggactgtatcatctga

DBGET integrated database retrieval system