KEGG   Rattus norvegicus (rat): 24684Help
Entry
24684             CDS       T01003                                 

Gene name
Prlr, RATPRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04630  Jak-STAT signaling pathway
rno04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    24684 (Prlr)
   04151 PI3K-Akt signaling pathway
    24684 (Prlr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24684 (Prlr)
   04060 Cytokine-cytokine receptor interaction
    24684 (Prlr)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    24684 (Prlr)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  Prolactin receptor family
   24684 (Prlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 24684
NCBI-ProteinID: NP_001029283
RGD: 3407
Ensembl: ENSRNOG00000057557
UniProt: P05710
Structure
PDB: 

Position
2q16
AA seq 610 aa AA seqDB search
MPSALAFVLLVLNISLLKGQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYS
KEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIV
EPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFT
GHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKDTTVWIIVAILS
AVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLEKGKSEELLSALGCQDFPPTS
DCEDLLVEFLEVDDNEDERLMPSHSKEYPGQGVKPTHLDPDSDSGHGSYDSHSLLSEKCE
EPQAYPPTLHIPEITEKPENPEANIPPTVDPQSTNPNFHVDAPKSSTWPLLPGQHMPRSP
YHSVADVCKLAGSPVNTLDSFLDKAEENVLKLSKALETGEEEVAKQKGAKSFPSDKQNTP
WPLLQEKSPTVYVKPPDYVEIHKVNKDGVLSLFPKQRENNQTEKPGVPETSKEYAKVSGI
MDNNILVLVPDSRAQNTALLEESAKKAPPSFEADQSEKDLASFTATSSNRRLQLGRLDYL
DPTCFMHSFH
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgcacttgctttcgtcctacttgttctcaacatcagcctcctgaagggacag
tcaccaccagggaaacctgagatccacaaatgtcgctctcctgacaaggaaacattcacc
tgctggtggaatcctgggacagatggaggacttcctaccaattattcactgacttacagc
aaagaaggagagaaaaccacctacgaatgtccagactacaaaaccagtggccccaactcc
tgcttctttagcaagcagtacacttccatctggaaaatatatatcatcacagtaaatgcc
acgaaccaaatgggaagcagttcctcggatccactttatgtggatgtgacttacatcgtt
gagccagagcctcctcggaacctgacattagaagtaaaacagctaaaagacaaaaaaaca
tatctgtgggtaaaatggtccccacccaccataactgatgtgaaaactggttggtttaca
atggaatatgaaattcgattaaagcctgaagaagcagaagagtgggagatccattttaca
ggtcatcaaacacagtttaaagtttttgacctatatccagggcaaaagtatcttgtccag
actcgctgcaagccagaccatggatactggagtagatggagccaggagagttccgttgaa
atgccaaatgacttcaccttgaaggacacaaccgtgtggatcattgtggccattctctct
gctgtcatctgtttgattatggtctgggcagtggctttgaagggctatagcatgatgacc
tgcatctttccaccagttcctgggccaaaaataaaaggatttgatacccatctgctggag
aagggcaagtctgaagagctgctgagtgccttggggtgccaagactttccccctacttct
gactgtgaggacttgctggtggagttcttagaagttgatgacaatgaggacgagcggcta
atgccatcccattccaaagagtatccaggtcaaggtgttaagcccacacacctagatccc
gacagtgactctggtcacggaagctatgacagccattctcttttatctgaaaagtgtgag
gaaccccaggcctacccccctactttgcacatccctgagatcactgagaagccagagaat
cctgaagcaaatattcctcccaccgtggacccccaaagcaccaaccccaattttcatgta
gatgcacccaaatcttcaacatggccattactgcctggccaacacatgcccagatctcct
taccacagtgttgctgatgtgtgcaagctagccggaagtcctgtgaatacactggactct
ttcttggacaaagcagaggaaaatgttctaaagttgtctaaagcccttgagactggagag
gaagaagtggctaagcaaaaaggggcaaaaagcttcccttctgacaaacaaaacacacct
tggccgctgctccaggagaaaagccccactgtctatgttaaacccccagattatgtggag
attcacaaagtcaacaaagatggagtgctatcattattccccaagcagagagaaaacaac
cagacagagaagcctggggttcctgaaaccagtaaggagtatgccaaggtgtctggcatt
atggataacaatatcctcgtattagtgccagactcacgagcccagaacacagcgttgctc
gaggaatcagccaagaaggctccaccatcgtttgaagctgaccaatctgagaaagatctg
gccagcttcactgcaacctcaagcaaccgcagactccaactgggtaggctggattacctg
gatcctacgtgcttcatgcactcctttcactga

DBGET integrated database retrieval system