KEGG   Rattus norvegicus (rat): 24688
Entry
24688             CDS       T01003                                 

Gene name
Prph
Definition
(RefSeq) peripherin
  KO
K07607  peripherin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    24688 (Prph)
   05022 Pathways of neurodegeneration - multiple diseases
    24688 (Prph)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24688 (Prph)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     24688 (Prph)
SSDB
Motif
Pfam: Filament Filament_head BLOC1_2 Laminin_II DUF3944 Baculo_PEP_C HALZ
Other DBs
NCBI-GeneID: 24688
NCBI-ProteinID: NP_036765
RGD: 3414
Ensembl: ENSRNOG00000052880
UniProt: Q496Z5 F1M7P4
Position
7
AA seq 473 aa
MPSSASMSHHSSGLRSSISSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSGSPSSS
ARLGSFRAPRAGALRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRF
LEQQNAALRGELSQARGQEPARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLG
ALKQRLEEETRKREDAEHNLVLFRKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELR
DLQVSVESQQVQQVEVEATVKPELTAALRDIRAQYENIAAKNLQEAEEWYKSKYADLSDA
ANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAG
AARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASL
SLKTTVPEVEPPQDSHSRKMVLIRTIETRDGEVVTESQKEQHSELDKSSIHSY
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgccatcttccgccagcatgagccatcactcgtcgggcctccggtccagcatcagctcc
acctcataccgccggaccttcgggccaccgccctcactgtcccccggggctttctcctac
tcatccagctctcgcttctccagcagccgcctgctgggctcggggtccccgagctcctcg
gcgcggctgggcagcttccgtgcccctcgagcgggggccctgcgcttgccctcggagcgc
ctcgacttctccatggccgaggccctcaaccaggagttcctggccactcggagcaacgag
aagcaagagctacaggagctcaacgaccgcttcgccaacttcatcgagaaggtgcgcttc
ctggagcagcagaacgcagccctgcgcggggagctgagccaggcgcggggccaggagccg
gcgcgcgccgaccagctgtgccagcaggagctgcgcgagctgcggcgcgaactggagctg
ctgggccgggagcgcgaccgggtgcaggtggagcgcgacgggctggcggaggacctgggg
gcgctcaagcagaggttagaagaagaaactcgcaagcgggaggatgcggagcacaacctg
gtgctcttccgtaaggacgtggacgacgccacgctgtcccgcctagaactagagcgcaag
atcgaatctctgatggacgaaattgagttcctcaagaagctacacgaagaggagcttcga
gacctgcaggtgagcgtggagagccagcaggtgcagcaggtggaggtagaggcaacagtg
aagccagagctgaccgcggcgctgagggacatccgtgcacagtatgagaacatcgcggcg
aagaatctgcaggaggcagaggagtggtataagtcaaaatacgctgacctgtccgatgct
gccaaccgcaaccatgaggccctacgtcaggccaagcaggagatgaacgagtcccgacgt
cagatccagagtctgacgtgcgaagtggacgggcttcgtggcacgaacgaggcactgctc
agacagttgcgggagctggaggagcagttcgccctggaggctggagggtaccaagcaggc
gcagcacggctggaggaagagcttcgacagctgaaggaagagatggcgaggcacctgcga
gagtaccaggagctcctcaacgtcaagatggccctggacatcgagatagccacctacagg
aagctactggaaggggaagagagccggatctcagtgcccgttcattcctttgcttcccta
agtttaaagacgactgtgcctgaggtggagcctccccaggacagccacagccggaagatg
gttctgatcaggactatcgagactcgggatggggaggtggtgacagagtctcagaaggag
cagcacagtgaactggacaagtcttctattcacagctactga

DBGET integrated database retrieval system