KEGG   Rattus norvegicus (rat): 24699
Entry
24699             CDS       T01003                                 

Gene name
Ptprc
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase C isoform 4 precursor
  KO
K06478  receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04660  T cell receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05132  Salmonella infection
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24699 (Ptprc)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    24699 (Ptprc)
   04666 Fc gamma R-mediated phagocytosis
    24699 (Ptprc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24699 (Ptprc)
  09163 Immune disease
   05340 Primary immunodeficiency
    24699 (Ptprc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24699 (Ptprc)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    24699 (Ptprc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     24699 (Ptprc)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    24699 (Ptprc)
CD molecules [BR:rno04090]
 Proteins
  24699 (Ptprc)
SSDB
Motif
Pfam: Y_phosphatase CD45 fn3 Y_phosphatase3 PTP_N PTPlike_phytase DSPc SCIMP GnsAB_toxin
Other DBs
NCBI-GeneID: 24699
NCBI-ProteinID: NP_612516
RGD: 3451
Ensembl: ENSRNOG00000000655
UniProt: P04157
Structure
PDB: 
5FN8

Position
13
AA seq 1273 aa
MYLWLKLLAFSLALLGPEVFVTGQGTTDDGLDTTEIVLLPQTDPLPARTTEFTPPSISER
GNGSSETTYLPGFSSTLMPHLTPQPDSQTPSARGADTQTLSSQADLTTLTAAPSGETDPP
GVPEESTVPETFPGGTPILARNSTAPSPTHTSNVSTTDISSGANLTTPAPSTLGFASNTT
TSTEIATPQTKPSCDEKFGNVTVRYIYDDSSKNFNANLEGDKKPKCEYTDCEKELKNLPE
CSQKNVTLSNGSCTPDKIINLDVPPGTHNFNLTNCTPDIEANTSICLEWKIKNKFTCDIQ
KISYNFRCTPEMKTFALDKHGTLWLHNLTVRTNYTCAAEVLYNNVILLKQDRRVQTDFGT
PEMLPHVQCKNSTNSTTLVSWAEPASKHHGYILCYKKTPSEKCENLANDVNSFEVKNLRP
YTEYTVSLFAYVIGRVQRNGPAKDCNFRTKAARPGKVNGMKTSRASDNSINVTCNSPYEI
NGPEARYILEVKSGGSLVKTFNQSTCKFVVDNLYYSTDYEFLVYFYNGEYLGDPEIKPQS
TSYNSKALIIFLVFLIIVTSIALLVVLYKIYDLRKKRSSNLDEQQELVERDEEKQLINVD
PIHSDLLLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKDARKSQNQNKNRYVDILPYDY
NRVELSEINGDAGSTYINASYIDGFKEPRKYIAAQGPRDETVDDFWKMIWEQKATVIVMV
TRCEEGNRNKCAEYWPCMEEGTRTFRDVVVTINDHKRCPDYIIQKLSIAHKKEKATGREV
THIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLE
SLEAEGKVDVYGYVVNLRRQRCLMVQVEAQYILIHQALVEYNQFGETEVNLSELHSCLQN
LKKRDPPSDPSPLEAEYQRLPSYRSWRTQHIGNQEENKKKNRSSNVVPYDFNRVPLKHEL
EMSKESEAESDESSDEDSDSEETSKYINASFVMSYWKPEMMIAAQGPLKETIGDFWQMIF
QRKVKVIVMLTELMSGDQEVCAQYWGEGKQTYGDMEVMLKDTNKSSAYILRAFELRHSKR
KEPRTVYQYQCTTWKGEELPAEPKDLVTLIQNIKQKLPKSGSEGMKYHKHASILVHCRDG
SQQTGLFCALFNLLESAETEDVVDVFQVVKSLRKARPGMVGSFEQYQFLYDIMASIYPTQ
NGQVKKANSQDKIEFHNEVDGAKQDANCVQPADPLNKAQEDSKEVGASEPASGSEEPEHS
ANGPMSPALTPSS
NT seq 3822 nt   +upstreamnt  +downstreamnt
atgtatttgtggctcaaacttctggccttcagcttggcccttctcggcccagaagtcttt
gtcacagggcaaggaacaaccgacgatggactggacacaacagagattgttcttctgcct
caaactgaccctttacctgctcgcaccactgaattcacacccccaagcatctctgaaaga
ggaaatggctcctcagagaccacatatcttccaggtttttcatccacgctgatgcctcac
ctgaccccacagcctgactcacagaccccctctgccagaggagctgacactcagacactc
agcagccaagctgacctcaccacactcacggctgctcccagcggcgagactgacccacca
ggtgtgcccgaagagagtactgtaccggagacctttcctggaggcacccccatccttgca
cgcaacagcactgctccctcacctacacacacttccaatgtcagcaccacagatatctcc
tcaggtgccaacctcacaacccctgcaccatccactctgggctttgcaagcaataccacc
acaagcacagaaatagctacccctcaaacgaagccatcatgtgatgaaaaatttgggaac
gttactgtgcgttacatctatgatgacagtagtaagaattttaacgcaaacctagaaggt
gacaaaaaacctaagtgtgaatatacggattgtgaaaaagagttaaaaaatctaccagaa
tgctcacagaaaaacgtcactctctccaatggctcatgtactccagataaaattataaat
ttagatgtaccaccagggactcacaactttaacttaacaaactgcacaccagacatagaa
gctaatacctcaatttgtttggagtggaaaataaaaaacaaatttacctgcgacattcaa
aagatttcatacaatttccgttgtacaccagagatgaaaacatttgctttggacaaacac
ggaacactttggttacacaaccttacagtccgaacaaattacacatgtgctgcggaagtc
ctctacaataacgtaatacttttaaaacaagacagaagggtgcagactgattttgggact
ccagaaatgcttccccatgttcaatgtaagaattcaactaacagcacaacattagtctcc
tgggctgagccagcatctaaacaccatggatacattttatgctataaaaagaccccttca
gaaaaatgtgaaaatttggctaatgatgtgaacagttttgaggtgaaaaacctgaggcct
tatacagagtacacagtgtctctatttgcctatgttattgggagggtgcaacgaaatggc
cctgctaaggattgcaactttcggacaaaagcagctcgtccaggcaaagtcaatggtatg
aaaacctcccgggcgtcagacaatagtataaatgtcacgtgtaattctccttatgaaatt
aatggccctgaagcgcgttacattttggaagtcaaaagtggaggttctttagttaaaact
ttcaaccaatccacatgtaaatttgttgtagacaatctctattattcaactgactatgag
tttctggtctatttttacaatggagagtacctgggagacccagaaataaaacctcaatca
acatcttataattctaaagcactgattatattcctggtgtttctgattattgtgacatca
atagccctgcttgttgttttgtataaaatctatgatctgcgtaagaaaagatccagcaat
ttagatgaacagcaggaactcgttgaaagggatgaggagaagcagctgataaatgtggac
ccaattcattctgaccttttgttggaaacatacaaaagaaagattgccgatgagggtaga
ctgttcctggctgaatttcagagcattccacgggtattcagcaagtttcccatcaaagat
gcccgaaagtcccaaaaccagaacaaaaaccgttatgtggacattctcccctatgattac
aaccgtgtggagctctctgaaataaatggagacgcagggtccacctacataaatgccagc
tacattgatggcttcaaggaacccaggaaatacattgctgcacaagggccccgggatgag
acagttgatgacttctggaagatgatctgggagcagaaggccacagttattgtcatggtc
acacgatgtgaagaaggaaacaggaacaagtgtgcagaatattggccatgcatggaggaa
ggcactcggactttcagagatgttgtcgtgacgatcaatgaccacaaacgatgtcctgat
tacattatccagaagctgagcattgcccacaaaaaagaaaaagcaactggaagagaagtg
actcatattcaattcaccagttggccagaccatggggttcctgaagaccctcacctgctc
ctgaaacttcgacggagagttaatgcttttagcaacttcttcagtggacccattgtggtg
cactgcagtgctggcgttgggcgtacaggcacctacattggaattgatgccatgctcgaa
agcctagaagcagagggcaaagtggatgtctatggctatgttgtcaacctaaggcgacag
agatgtctgatggtgcaagtggaggcccagtacatcctgatccatcaggccttagtggag
tacaatcaatttggggaaacagaagtgaacttgtctgagttacattcatgtctacagaat
ctgaagaagagagatccacccagtgacccgtctcctttggaggctgagtaccagagactt
ccttcatacaggagctggaggacacagcacattggaaatcaagaagaaaataaaaagaaa
aacaggagttctaacgttgttccatatgactttaacagagtgccacttaagcatgaacta
gagatgagcaaagagagcgaggctgaatccgacgaatcttcagatgaggacagtgactcg
gaagaaaccagcaaatacattaatgcgtcatttgtgatgagttactggaaaccagaaatg
atgattgctgcccagggtccactaaaagagactattggtgacttttggcagatgatattc
caaagaaaagtcaaggttattgtgatgttgacagagttaatgagtggagaccaggaagtc
tgtgctcaatactggggagaaggaaagcagacttatggagacatggaagtaatgttgaaa
gacacgaacaaatcctcagcctatattctgcgagcatttgaactgagacattccaagaga
aaggagcctagaactgtgtaccagtaccagtgtaccacatggaaaggggaggagctccct
gcagaacccaaagatctagtgactctgattcagaacatcaaacagaagcttcccaagagt
ggctcagaagggatgaagtaccacaagcatgcatcaatcctagtccactgcagggatgga
tcccagcagacggggttgttctgtgctctgttcaatctcctggaaagtgcagaaacagaa
gatgtggttgatgtttttcaagtggtaaagtctctacgcaaagcacggccggggatggtg
ggcagctttgagcaataccagttcctctatgacatcatggccagcatctatcccacccag
aatggacaagtgaagaaagcaaacagccaagacaaaattgaatttcataacgaagtggac
ggagccaagcaggacgcaaactgtgttcagccagctgatcctctgaacaaagcccaggaa
gacagcaaagaagttggagcttcagagcctgcaagtggttctgaggagccagaacattct
gcaaatggtcccatgagcccagctctaaccccgagctcatag

DBGET integrated database retrieval system