KEGG   Rattus norvegicus (rat): 24766
Entry
24766             CDS       T01003                                 

Gene name
Scn2a
Definition
(RefSeq) sodium channel protein type 2 subunit alpha
  KO
K04834  voltage-gated sodium channel type II alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    24766 (Scn2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24766 (Scn2a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   24766 (Scn2a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc Na_trans_cytopl PKD_channel ATP-synt_B GPHH IQ FUT8_N_cat
Other DBs
NCBI-GeneID: 24766
NCBI-ProteinID: NP_036779
RGD: 3632
Ensembl: ENSRNOG00000005018
UniProt: P04775
Structure
PDB: 
2M5E 2KXW 1BYY

Position
3
AA seq 2005 aa
MARSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRK
LAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFEINITSFFNNSL
DWNGTAFNRTVNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQAGEEEKEDAVRKSASEDSIRKKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFKGRVKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRPSNVSQASRASRGIPTLPMNGKMHSAVDCNGVVSLVGGP
SALTSPVGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPSRQRAMSMASILTNTMEELEE
SRQKCPPCWYKFANMCLIWDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEH
YPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL
ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGM
QLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCL
TVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRK
IREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGS
SVEKYVVDESDYMSFINNPSLTVTVPIALGESDFENLNTEEFSSESDMEESKEKLNATSS
SEGSTVDIGAPAEGEQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKT
CYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLK
WVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRF
EGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVV
NNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQ
PKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNA
MKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMT
NILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFV
SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS
NFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGS
SVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYE
VWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFA
FTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYL
LKQKVKKVSSIYKKDKGKEDEGTPIKEDIITDKLNENSTPEKTDVTPSTTSPPSYDSVTK
PEKEKFEKDKSEKEDKGKDIRESKK
NT seq 6018 nt   +upstreamnt  +downstreamnt
atggcacggtcagtgctggtacctccaggacctgacagcttccgcttctttaccagggaa
tcccttgctgctatcgaacagcgcattgcagaagagaaagctaagagacccaaacaggaa
cgcaaggacgaagacgatgaaaatggcccaaagccaaatagtgacttggaagcaggaaaa
tcccttccttttatttatggagacattcctccagagatggtgtcagaaccactggaggac
ctggacccctactatatcaataagaaaacctttatagtattgaataaggggaaagcaatc
tcgcggttcagcgccacctctgccctgtacattttaactcccttcaaccccattagaaaa
ttagctattaagattttggtacattctttattcaatgtgcttatcatgtgcacaattctt
accaactgtgtgtttatgaccatgagtaaccctccagactggacaaagaatgtggagtat
acttttacaggaatttatacttttgaatcacttattaaaatccttgcaaggggcttttgt
ctagaagatttcacatttctacgggatccctggaattggttggatttcacagtcattact
tttgcgtatgtaacagaatttgtaaacctaggcaatgtttcagctcttcgaactttcaga
gtcttgagagctttgaaaactatttctgtaattccaggcctgaagaccatcgtgggggcc
ctgatccagtcagtgaagaagctctctgacgtcatgatcctcaccgtgttctgtctcagt
gtctttgctctaatcgggctgcagctcttcatgggcaacctgaggaataaatgcttgcag
tggcccccagacaattctacctttgaaataaatatcacttccttctttaataactcattg
gattggaatggtactgccttcaataggacggtgaacatgtttaactgggacgaatatatt
gaagataaaagtcacttttattttttggaaggacaaaacgatgctctgctttgtgggaac
agctcggatgctggacagtgtccagaaggatacatctgtgtgaaggctgggagaaacccc
aactacggctacacaagttttgacaccttcagctgggccttcttgtccttatttcgtctc
atgactcaagacttctgggaaaacctttatcagctgaccttgcgtgctgccgggaaaaca
tacatgatattttttgtgctggtcattttcttgggctcattctacctgataaatttgatc
ctggctgtggtggccatggcctacgaggaacagaaccaggccacactggaggaggctgaa
cagaaggaggcagagtttcagcagatgctggagcaactgaagaagcagcaggaggaagct
caggcagcagctgcagcagcgtccgcagaatccagagacttcagcggggcaggcgggata
ggtgttttctcggagagttcgtcagtagcctcaaagttaagttccaaaagtgaaaaggag
ttgaaaaacagaagaaagaaaaagaaacagaaagaacaggctggggaggaagagaaggaa
gacgcggtgcggaaatctgcctctgaggacagcatacgaaagaaaggcttccggttttcc
ctggaaggaagtagattgacctacgagaagagattttcctctccgcaccagtctctcttg
agcatccgaggctccctattttctccaagacgcaacagtagagcaagccttttcagcttc
aaaggtcgagtgaaggatattggttccgaaaatgactttgcagacgatgaacacagcaca
tttgaggacaacgacagcagaagagactctctatttgtaccacacagacatggagaaagg
cgtcctagcaatgtcagccaggccagccgtgcctcccgggggatacccactctacccatg
aatgggaagatgcacagtgcagtggactgcaacggtgtggtgtccctggttggaggcccc
tctgcgctcacatcgcctgtggggcagctgctgccggagggcacaactactgagacagaa
ataaggaagaggagatccagttcttaccacgtctctatggacttgttggaagacccttca
aggcaaagggcaatgagtatggccagtattttgacgaacactatggaagaacttgaagaa
tccagacagaaatgcccaccctgctggtataaatttgctaatatgtgcctgatttgggac
tgttgtaagccatggctaaaggtaaaacacgttgtcaatctggtagtgatggatccattt
gttgacctggccatcaccatctgcattgtgttaaatacgctcttcatggccatggagcac
taccccatgactgagcagttcagcagtgtgctgtctgttgggaatttggtcttcactggg
atcttcacggcagaaatgtttctcaagataatagccatggatccatattattacttccaa
gaaggctggaatatctttgatggctttatagtgagccttagtttaatggaactcggcttg
gcgaatgtggaaggattgtcagttctccgatcattccggctgcttagagtcttcaagttg
gcaaagtcctggcccacactgaacatgctcattaagatcatcggcaactcggtgggtgca
ctgggcaacctgaccctggtgctggccatcatcgtcttcatttttgctgtggtcggcatg
cagctgtttggaaagagctacaaggagtgtgtctgtaagatttccaatgattgtgagctc
ccgcgctggcacatgcacgacttcttccactccttcctgatcgtgtttcgagtgctgtgt
ggggagtggatagagaccatgtgggactgcatggaggtcgcgggccagaccatgtgcctt
actgtcttcatgatggtcatggtgattgggaaccttgttgtcctgaacctcttcttggcc
ttgctcctcagttctttcagctcagacaacctggctgccacagatgacgataacgaaatg
aacaacctccagatagccgtgggaaggatgcagaagggaattgattttgttaaaaggaag
atacgtgaattcattcagaaagcctttgtcagaaagcagaaagctttagatgaaatcaaa
ccgctggaagatctgaataacaagaaagacagttgtatctccaaccacacgaccatagaa
ataggcaaggacctcaattacctcaaagatggaaacgggacgaccagtggcataggcagc
agtgtggagaagtatgtggtagatgagagtgattacatgtcgttcataaacaaccccagc
ctcaccgtgactgtgcccatcgcccttggagagtctgactttgaaaacttaaacacggaa
gaattcagtagtgagtcagatatggaagaaagcaaggagaaattgaatgcaactagctca
tctgagggcagtacggttgatataggcgctccggcagagggagagcagccagaggccgaa
ccggaagaatcgcttgaaccggaagcgtgtttcacagaagactgtgtgagaaagttcaag
tgttgtcagataagcatagaagagggcaaaggcaagctctggtggaacttgaggaaaacg
tgctacaagatagtagagcataactggtttgaaaccttcatcgtctttatgattctgctc
agcagtggtgctctggcctttgaagacatttatattgagcagcgaaagaccatcaagacc
atgctggagtatgctgacaaggttttcacttatatcttcatcctggagatgcttctaaag
tgggtggcctatggtttccaaatgtatttcaccaatgcctggtgctggctggacttcctg
atcgttgatgtctccttggttagcttaactgcaaatgccttgggctattcggaacttggt
gccatcaagtccctccgaacgttaagagctctgagacctctacgagccttatcccgattt
gaaggaatgagggttgttgtaaacgctctcttaggcgccatcccctccataatgaacgta
cttctggtctgcctgatcttttggctaatattcagtatcatgggggtgaatctctttgct
ggcaagttctaccattgcatcaactacaccacgggggaaatgtttgatgtgagcgtggtc
aacaactacagtgaatgccaagctctcattgagagcaatcagacggccaggtggaagaac
gtgaaggtcaacttcgataacgtgggactcggatacctttctctgctccaagtagccacc
tttaaaggatggatggatatcatgtatgcagctgttgactcaagaaatgtagaactgcag
cccaaatacgaagacaatctctacatgtacctttactttgtcatcttcatcatcttcggc
tcattcttcaccctgaacctgttcattggtgtcatcatagacaacttcaaccagcagaag
aagaagtttggaggtcaagacatctttatgacagaagaacagaagaaatactacaatgca
atgaagaagctcggctccaagaaaccgcagaagcccattcctcggcctgcaaacaaattt
caagggatggtctttgattttgtaaccaaacaagtctttgacatcagcatcatgatcctc
atctgcctcaacatggtgaccatgatggtggaaacggacgaccagagtcaggagatgacc
aacatcctgtactggatcaacctggtgttcattgtcctgttcacgggcgagtgtgtgctg
aagctcatctccctccgccattattatttcaccatcggctggaatatttttgattttgtg
gtagtcatcctctccattgtaggaatgtttctcgcggagctgatagagaagtatttcgtg
tcccctaccctgttccgagtcatccgcctggccaggattggacgaatcctacgcctgatc
aaaggcgccaaggggatccgcactctgctctttgctctgatgatgtcccttcctgcgctg
ttcaacatcggcctcctgcttttcctggtcatgttcatctacgccatctttgggatgtcc
aactttgcctacgttaagagggaagttggaattgatgacatgttcaactttgagactttt
ggcaacagcatgatctgcctgttccaaatcaccacctctgccggctgggacggactgctg
gcccctatactaaatagcggacctcctgactgtgaccctgaaaaagatcaccctggaagc
tcggtgaagggggactgtgggaacccatctgtggggattttcttttttgtcagctacatc
atcatatccttcctggtggtggtgaacatgtacatcgctgtcatcctggagaacttcagc
gtcgccaccgaagaaagtgcagagcctctgagtgaggacgactttgagatgttctacgag
gtctgggagaagttcgaccctgacgccactcagttcatagagttctgcaagctttctgac
tttgcagctgccctggatcctcccctcctcatcgcaaagccaaacaaagtccagctcatt
gccatggacctgcccatggtgagtggagaccgcatccactgcctggacatcttgtttgct
tttacaaagcgggtcctgggcgagagtggagagatggacgctcttcgaatccagatggaa
gaaaggttcatggcttccaacccctccaaggtctcttatgagcccattaccaccaccctg
aaacggaaacaagaggaggtgtctgctattgtcatccagcgagcatacaggcggtatctc
ctgaagcagaaagttaagaaagtttcgtctatctataaaaaagacaaaggtaaagaagac
gagggaacgcccatcaaagaagacatcatcacagataaactgaacgagaattcaactcca
gagaagactgatgtgacaccttccacaacttctccaccttcctacgatagcgtgacgaaa
ccggagaaggaaaaatttgaaaaggacaaatcagaaaaagaggacaaagggaaagatatc
agggaaagtaaaaagtaa

DBGET integrated database retrieval system