KEGG   Rattus norvegicus (rat): 24790
Entry
24790             CDS       T01003                                 

Gene name
Sp1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04137  Mitophagy - animal
rno04350  TGF-beta signaling pathway
rno04915  Estrogen signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05224  Breast cancer
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    24790 (Sp1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    24790 (Sp1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24790 (Sp1)
   04928 Parathyroid hormone synthesis, secretion and action
    24790 (Sp1)
   04927 Cortisol synthesis and secretion
    24790 (Sp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24790 (Sp1)
   05202 Transcriptional misregulation in cancer
    24790 (Sp1)
   05231 Choline metabolism in cancer
    24790 (Sp1)
  09162 Cancer: specific types
   05224 Breast cancer
    24790 (Sp1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    24790 (Sp1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    24790 (Sp1)
   05017 Spinocerebellar ataxia
    24790 (Sp1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    24790 (Sp1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24790 (Sp1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    24790 (Sp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24790 (Sp1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    24790 (Sp1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    24790 (Sp1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    24790 (Sp1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 24790
NCBI-ProteinID: NP_036787
RGD: 3738
Ensembl: ENSRNOG00000014084
UniProt: Q01714
Position
7
AA seq 786 aa
MSDQDHSMDEVTAVKIEKGVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPS
PLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPT
SKEQSGNSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQF
QTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQ
GLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESGSQPV
TSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTSQRV
GGLQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAP
LSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQA
QTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGT
SGIQVHQLPGLPLAIANTPGDHGAQLGLHGPGGDGIHDETAGGEEGENSPDPQPQAGRRT
RREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCN
WSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVAL
SVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSIN
ISGNGF
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactcaatggatgaagtgacagctgtgaagattgaaaaaggtgtt
ggtggcaataacgggggtagcgggaacggtggtggtgccgccttttctcagactcgaagc
agcagcacaggcagtagcagcagcagtggtggcggaggagggcaggaatcccagccatct
cctttggctctgctggcagcaacctgcagcagaattgagtcacccaatgagaacagcaac
aactcccagggtccgagtcagtcagggggcacaggtgaacttgacctcacagccacacaa
ctttcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacc
tcaaaggaacagagtggcaacagtaccaatggcagcaatggcagtgagtcttccaagaac
cgcacagtctctggtgggcagtatgttgtggctgctacccccaacttacagaaccagcaa
gttctgacaggtctacctggagtaatgcctaatattcagtatcaagtaatcccacagttc
cagactgttgatgggcaacagctgcagtttgctgccactggggcccaagtgcagcaggat
ggttctggtcaaatacagatcataccaggtgcaaatcaacagatcatcacaaatagagga
agtgggggcaacattattgctgctatgccaaatctactccagcaagctgtccccctccaa
ggccttgctaataatgtgctctcaggacagactcagtatgtgaccaatgtaccagtggcc
ctgaatgggaacatcaccttgctacctgtcaacagcgtttctgcagctaccctgactccc
agctctcaggcaggcacgatcagcagctctggatcccaggagagtggctcacagcctgtc
acctcagggactgccatcagttctgccagcttggtgtcatcacaagccagttccagctcc
tttttcaccaatgccaacagctattcaacaactaccaccaccagcaacatgggaattatg
aactttaccagcagcggatcatcagggactagttctcaaggccagacatcccagagagtt
ggtgggctgcaagggtctgattctctaaacatccagcagaaccagacatcaggaggatca
ctgcaaggaagtcagcaaaaagagggagagcaaagtcagcagacacagcaacaacaaatt
cttattcagcctcagctagttcaaggtggacaagctcttcaggccctccaagcagcacca
ttgtcaggacagaccttcacaactcaagctatttcccaggaaaccctccagaacctccag
cttcaggctgttcaaaactctggccccatcatcattcggacaccaaccgtggggcccaat
ggacaggtcagttggcagacccttcagctgcagaaccttcaagttcagaacccacaagcc
cagacaatcaccttggcccctatgcagggtgtttccttggggcagactagcagcagcaat
accacccttacacccattgcctcagctgcctccattcctgctggcacagtcactgtgaat
gctgctcaactgtcctccatgccaggcctccagaccattaacctcagtgcattgggtact
tcagggatccaggtgcaccagcttccaggcctgcctttggctatagcaaacaccccaggt
gatcatggagctcaacttggccttcatggacctggcggtgatggaatacatgatgagaca
gcaggtggagaagaaggagagaacagccctgatccccaaccccaagctggtcgcaggact
cggcgggaagcatgtacatgcccctattgtaaagacagtgaggggaggggctctggagat
cctggcaaaaagaaacagcacatttgtcatatccaaggatgcggcaaagtatatggcaaa
acctcacatctccgtgcacacttgcgctggcatacaggggagaggccattcatgtgtaat
tggtcatactgtgggaagcgctttactcgttcggatgagcttcagagacataaacgtaca
catacaggagagaagaaatttgcctgccctgagtgccctaagcgtttcatgaggagcgat
catctgtcaaagcatatcaagacccaccagaacaaaaagggaggcccaggtgtagccttg
agcgtgggcacattgcccctggacagtggggcaggttcagaaggcagtggcactgccact
ccttcagcccttattaccaccaatatggtagccatggaggccatctgtccagagggtatt
gcccgtcttgccaacagtggcatcaacgtcatgcaggtgacagagctgcagtccattaat
atcagtggcaatggtttctga

DBGET integrated database retrieval system