KEGG   Rattus norvegicus (rat): 24803
Entry
24803             CDS       T01003                                 

Gene name
Vamp2
Definition
(RefSeq) vesicle-associated membrane protein 2
  KO
K13504  vesicle-associated membrane protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04721  Synaptic vesicle cycle
rno04911  Insulin secretion
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    24803 (Vamp2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24803 (Vamp2)
  09154 Digestive system
   04970 Salivary secretion
    24803 (Vamp2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    24803 (Vamp2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    24803 (Vamp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24803 (Vamp2)
Membrane trafficking [BR:rno04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    24803 (Vamp2)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    24803 (Vamp2)
SSDB
Motif
Pfam: Synaptobrevin MCU PRIMA1 Orf78 MgtE CD34_antigen DUF2207 Ferlin_C Syndecan
Other DBs
NCBI-GeneID: 24803
NCBI-ProteinID: NP_036795
RGD: 3949
Ensembl: ENSRNOG00000006989
UniProt: P63045
Structure
PDB: 

Position
10
AA seq 116 aa
MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
NT seq 351 nt   +upstreamnt  +downstreamnt
atgtcggctaccgctgccaccgtcccgcctgccgccccggccggcgagggtggcccccct
gcacctcctccaaatcttaccagtaacaggagactgcagcagacccaggcccaggtggat
gaggtggtggacatcatgagggtgaatgtggacaaggtcctggagcgggaccagaagcta
tcggaactggatgatcgcgcagatgccctccaggcaggggcctcccagtttgaaacaagt
gcagccaagctcaagcgcaaatactggtggaaaaacctcaagatgatgatcatcttggga
gtgatttgcgccatcatcctcatcatcatcatcgtttacttcagcacttaa

DBGET integrated database retrieval system