KEGG   Rattus norvegicus (rat): 24916
Entry
24916             CDS       T01003                                 

Gene name
Rnf112, BFP, Bfb, Zfp179, Znf179
Definition
(RefSeq) ring finger protein 112
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: GBP zf-C3HC4_4 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX
Other DBs
NCBI-GeneID: 24916
NCBI-ProteinID: NP_619516
RGD: 3986
Ensembl: ENSRNOG00000002364
UniProt: O70418
Position
10q22
AA seq 631 aa
MPRPVLSVTAFCHRLGKRESKRSFMGNSSNSWSHASFPKLELGLGQRPSPPRESPTCSIC
LERLREPISLDCGHDFCIRCFSTHRIPGCELPCCPECRKICKQKKGLRSLGERMKLLPQR
PLPPALQETCAVRAERLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLLAVLGEQHS
GKSFLLDHLLRGLPGLESGDSTRPRAEGSLPGIRWGANGLTRGIWMWSHPFLLGKEGKKV
AVFLVDTGDVMSPELSRETRVKLCALTMMLSSYQILNTSQELKDTDLGYLEMFVHVAEVM
GKHYGMVPIQHLDLLVRDSSHHNKSGQGHVGDILQKLSGKYPKVQELLLGKRARCYLLPA
PERQWVNKGQASPGGNTEDDFSHHFRAYISDVLSTAPQHAKSRCQGYWSEGRAMARGDRR
LLTGQQLAQEIKNLSGWMGKSGPSFSSPDEMAAQLHDLRKVEAAKKEFEEYVRQQDIATK
RIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKEREQTLEALEAELQAEAKAFMDSYT
MRFCGHLAAVGGAVGAGLMGLAGGVVGAGMAAAALAAEAGMVAAGAAVGATGAAVVGGGV
GAGLAATVGCMEKEEDERVQGGDREPLLQEE
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgccgaggccagtcctgtcagtcactgctttttgtcatcggcttggcaaacgggagagc
aaacgaagcttcatgggaaacagcagcaacagttggtcccatgcatcattccccaagctg
gagctgggcctgggacagcgtccctccccaccccgggagtcgcctacctgctccatctgt
ctggaaaggcttcgagagcctatctcactggactgtggccacgacttctgcatccgatgc
ttcagcacacatcgcatcccaggctgtgagctgccatgctgtcctgaatgccggaaaatc
tgtaagcaaaagaagggccttcgcagtctaggggagaggatgaagctcctacctcagcgg
ccgctgccccctgcactgcaggagacctgtgctgtgagagcggagcgtctgctgttggta
cgcatcaatgcctctggaggcctcatcctcaggatgggagccataaaccgctgcctgaag
caccctctggccagggacacacctgtctgcttgcttgctgtcctgggagagcagcactca
ggaaagtccttcctcttggaccacttgctcagaggcttaccaggcctggaatccggagac
agcactaggcccagagcagaggggtctctgcctggaatcagatggggtgctaatggtctc
acgaggggcatctggatgtggagtcaccccttcctgctgggaaaagaagggaagaaggtg
gctgtgttcttagtggacacaggagatgtcatgagcccagaactgagcagggagacaagg
gtcaagctctgtgccctcaccatgatgctcagttcgtaccagatcctcaacacctcccaa
gagctgaaggacacagatctgggctatctagagatgttcgttcatgtggctgaggtgatg
ggcaaacattatgggatggtacccatccagcatctggatctcttagtccgtgactcttcc
catcacaataagtcagggcaggggcacgtgggtgatatactccagaagctgtccggcaaa
taccccaaggtccaagagctgctcctagggaaacgggcccgctgttacctccttcctgct
cctgagagacagtgggtgaacaaaggccaagcaagcccaggaggcaacacagaagatgac
ttctcccaccatttccgggcctacatctcggatgtgctgagcacagcccctcagcatgct
aagagccgctgccaagggtactggagtgagggtcgcgccatggccaggggggacagacgc
ctactcacagggcagcagctggcacaggagatcaagaacctctccggctggatggggaag
agtgggcccagtttcagctctccagatgagatggctgctcaacttcatgacctgaggaaa
gtggaagccgccaagaaggagtttgaagagtatgtgagacagcaggacatagccaccaag
cgcatcttctctgcactacgagtactgcccgacactatgaggaacctcctctctacccag
aaggatgctatcttggcccgccatggtgtggccctgttgtgcaaggagagagagcagacc
ttggaggccctggaagccgagctgcaggcagaagccaaggccttcatggactcctacaca
atgcgcttctgtggccacctggccgcggtagggggcgctgtaggtgctggactcatgggc
ctggcagggggtgtggtgggcgccggtatggcggcagcagcgttggctgcagaagctggg
atggtggcagccggggcagcggtgggtgccactggggctgctgtagttgggggtggtgtg
ggtgctgggctggccgcgacggtgggctgcatggagaaagaggaagatgagagagttcaa
ggaggagaccgagagcccctactccaggaagaataa

DBGET integrated database retrieval system