KEGG   Rattus norvegicus (rat): 24925Help
Entry
24925             CDS       T01003                                 

Gene name
Adrb1, B1AR, RATB1AR
Definition
(RefSeq) adrenoceptor beta 1
  KO
K04141  adrenergic receptor beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04261  Adrenergic signaling in cardiomyocytes
rno04540  Gap junction
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04970  Salivary secretion
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24925 (Adrb1)
   04024 cAMP signaling pathway
    24925 (Adrb1)
   04022 cGMP-PKG signaling pathway
    24925 (Adrb1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24925 (Adrb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24925 (Adrb1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    24925 (Adrb1)
   04924 Renin secretion
    24925 (Adrb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24925 (Adrb1)
  09154 Digestive system
   04970 Salivary secretion
    24925 (Adrb1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    24925 (Adrb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24925 (Adrb1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    24925 (Adrb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 24925
NCBI-ProteinID: NP_036833
RGD: 2059
Ensembl: ENSRNOG00000017002
UniProt: P18090
Position
1q55
AA seq 466 aa AA seqDB search
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG
MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRP
SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA
FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD
DDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgggggcgctcgccctgggcgcctccgaaccctgcaacctgtcgtcggccgcg
ccgctgcccgacggcgcggccaccgcggcacgactgctggtgctcgcgtcgcctcccgcc
tcgctgctgcctccagccagcgagggctcagcgccgctgtcgcagcagtggaccgcgggt
atgggcctactcctggcgctcatcgtgctgctcatcgtagtgggcaacgtgttggtgatc
gtggccatcgccaagaccccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgatctggtcatgggactgctggtggtgcctttcggggccaccattgtggtg
tggggccgctgggagtacggctccttcttctgtgagctctggacttcggtagacgtgcta
tgtgtgacggccagcatcgagaccctgtgtgtcatcgccctggaccgctacctcgccatc
acgctgccctttcgctaccagagcctgctgacgcgcgcgcgagcgcgggccctcgtgtgc
acagtgtgggccatctccgcgctggtgtccttcctgcccatcctcatgcactggtggcgg
gccgagagcgacgaagcgcgccgctgctacaacgaccccaagtgctgcgatttcgtcacc
aaccgggcctacgccatcgcctcgtccgtcgtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctccgggtgttccgcgaggcccagaaacaggtgaagaagatcgacagc
tgcgagcgccgcttcctcacgggcccgccccggccgccctcgcccgcgccctcgccatca
ccagggccaccgcgccccgcagactcgctggccaacgggcgctccagcaagcggcggccg
tcgcgcctcgtggctctgcgagagcagaaggcgctcaagacactgggcatcatcatgggt
gtgttcacgctctgctggctgcccttcttcctggccaacgtggtgaaagctttccaccgc
gacctggtgccggatcgcctcttcgtcttcttcaactggctgggctacgccaactcggcc
ttcaaccccatcatctactgccgcagccccgacttccgcaaggctttccagcgcctgctt
tgctgcgcgcgccgggccgcctgcagacgccgcgcagcccacggggaccggccgcgcgcc
tcgggctgcctggcgagagctgggccgccgccgtcccccggggctccttcggacgacgac
gacgatgacgccggggccaccccacccgcgcgcctgttggagccctgggccggctgcaac
ggcgggacgaccactgtggacagcgattcgagcctggacgagccgggacgccagggcttc
tcctccgagtccaaggtgtag

DBGET integrated database retrieval system