KEGG   Rattus norvegicus (rat): 24954Help
Entry
24954             CDS       T01003                                 

Gene name
Insr
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04520  Adherens junction
rno04910  Insulin signaling pathway
rno04913  Ovarian steroidogenesis
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04960  Aldosterone-regulated sodium reabsorption
Module
rno_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24954 (Insr)
   04015 Rap1 signaling pathway
    24954 (Insr)
   04010 MAPK signaling pathway
    24954 (Insr)
   04066 HIF-1 signaling pathway
    24954 (Insr)
   04068 FoxO signaling pathway
    24954 (Insr)
   04072 Phospholipase D signaling pathway
    24954 (Insr)
   04022 cGMP - PKG signaling pathway
    24954 (Insr)
   04151 PI3K-Akt signaling pathway
    24954 (Insr)
   04152 AMPK signaling pathway
    24954 (Insr)
   04150 mTOR signaling pathway
    24954 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    24954 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    24954 (Insr)
   04923 Regulation of lipolysis in adipocyte
    24954 (Insr)
   04913 Ovarian Steroidogenesis
    24954 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24954 (Insr)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    24954 (Insr)
   04213 Longevity regulating pathway - multiple species
    24954 (Insr)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    24954 (Insr)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    24954 (Insr)
   04931 Insulin resistance
    24954 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24954 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:rno04090]
    24954 (Insr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24954 (Insr)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   24954 (Insr)
CD molecules [BR:rno04090]
 Proteins
  24954 (Insr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476
Motif
Other DBs
NCBI-GeneID: 24954
NCBI-ProteinID: NP_058767
RGD: 2917
Ensembl: ENSRNOG00000029986
Vega: OTTRNOG00000001719
UniProt: T2CB11
Structure
PDB: 

Position
12p12
AA seq 1384 aa AA seqDB search
MGSGRGCETTAVPLLMAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHYKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWNKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRKTSSGNGAEDTRPSRKRRSLEEVGNVTATTPTLP
DFPNISSTIAPTSHEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAA
YVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHL
CVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKII
IGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEV
PREKITLLRELGQGSFGMVYEGNAKDIIKGEVETRVAVKTVNESASLRERIEFLNEASVM
KGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQ
MTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLL
PVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPP
DNCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELE
MEFEDMENVPLDRSSHCQREEAGCREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPR
SNPS
NT seq 4155 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgggagaggatgtgagacgacggcggtgccgttgctgatggccgtggccgcg
ttgctggtgggcacagccggccacctgtaccctggagaggtgtgcccgggaatggacatc
cggaacaacctgaccaggttgcatgagctggagaactgctcggtcattgagggccatctg
cagatcctcttgatgttcaagaccagacccgaagatttccgagacctcagtttccccaaa
ctcatcatgatcacagactacctgcttcttttccgtgtctatggcctagaaagtctaaaa
gacctcttcccaaacctcacagtcatccgaggctcccgtctcttcttcaactatgccctg
gtcatcttcgagatggtccacctgaaggagctgggtctttacaacctcatgaacatcacc
cggggctctgtccgcatcgagaagaataatgaactctgctacctggccactatcgactgg
tcccgcatcctggattccgtggaggacaactacattgtactgaacaaagatgacaatgag
gaatgtggggacgtctgtccaggcacagccaagggcaagaccaactgccctgccaccgtc
atcaatgggcagtttgtggaacggtgctggacacacagtcattgtcagaaagtttgccca
accatctgtaagtcacatggctgcacagctgaaggcctgtgctgtcacaaggagtgcctg
ggcaactgttcagaacccgatgaccctaccaagtgtgtggcctgtcgaaacttctacctg
gatggtcagtgtgtggagacctgcccaccaccctactatcacttccaggattggcgctgt
gtaaacttcagcttctgccaagaccttcactacaaatgcaggaactctcggaagcctggc
tgtcaccaatacgtcattcacaacaacaagtgcatccccgagtgcccgtctggctatacc
atgaattccagcaacttgatgtgcaccccgtgtctgggaccctgtcctaaggtctgccaa
atcctcgaaggcgagaagaccattgattccgtgacatctgcccaggagctccgaggctgc
actgtgatcaatggcagcctgattatcaacatccgagggggcaacaacctggcagctgaa
ctagaggctaaccttggcctcattgaagaaatctcagggttcctaaagatccgtcgctcc
tatgctctggtgtcactttctttcttcaggaagctacatctgattcgaggagagaccttg
gaaattgggaactattctttctacgccttggacaaccagaacctgaggcagctgtgggac
tggaacaagcacaacctcacgatcactcagggcaagctcttcttccactacaaccccaaa
ctctgcctgtctgagatccacaagatggaggaagtgtccggaaccaagggccgccaggag
aggaacgacattgccctgaagaccaacggggaccaggcatcctgtgaaaatgaattactt
aaattctctttcatccggacgtcttttgacaagatcttgctgaggtgggagccctactgg
ccccccgacttccgagatctcctgggattcatgctgttctacaaagaggccccttatcag
aacgtgacagagtttgacgggcaggatgcgtgtggctccaacagctggactgtggtggat
attgacccgccccagaggtccaacgaccctaagtctcagaccccaagccaccctgggtgg
ctgatgcggggcctcaaaccctggacccagtatgccatctttgtcaagaccttggttacc
ttctctgatgaacgccggacctatggagccaaaagtgatatcatctatgtgcaaacagat
gccaccaatccttccgttcccctggatcccatatcagtttccaactcctcatctcagatt
atcttaaagtggaagcccccctcggaccccaatggcaacatcacacactacctggtctac
tgggagaggcaggcggaggacagcgagctgttcgagttggattattgtctcaaagggctg
aagctcccctcacgcacctggtccccaccttttgagtctgacgattctcaaaagcacaat
cagagtgagtatgacgactcggccagcgagtgctgctcatgtcctaagactgactctcag
atcctgaaggagctggaggagtcttcattcaggaagaccttcgaggattacctgcacaac
gtggtttttgttcccagaaaaacctcttcaggcaatggtgctgaggacactaggccatcc
cgaaagcgaagatcccttgaagaggtgggcaatgtgacagccactacacccacacttcca
gattttcccaacatctcctccaccatcgcgcccacaagccacgaagagcacagaccattt
gagaaagtagtaaacaaggagtcacttgtcatctctggcctgagacacttcactgggtac
cgcattgagctgcaggcatgcaatcaggactccccagaagagaggtgcagcgtggctgcc
tacgtcagtgcccggaccatgcctgaagctaaggcagatgacatcgttggccctgtgacc
catgaaatctttgagaacaatgttgtacacttaatgtggcaagagccaaaggaacctaat
ggtctgattgtgctatatgaagtgagctatcggcgatatggtgatgaggagctgcacctc
tgtgtctcccggaagcattttgccctggagcggggctgcaggcttcgagggctctctcca
ggaaactacagtgttcgagtccgggctacctctctggcaggaaatggctcctggacagaa
cccacctatttttatgtgactgattatttagatgtcccatcaaatattgccaaaattatc
atcgggcccctcatcttcgtcttcctcttcagtgtcgtgatcggaagtatttatctattc
ttgaggaagaggcagccagatgggccaatgggaccactgtacgcttcttcaaacccagag
tacctcagtgccagtgatgtctttccatcttccgtatacgttccggatgagtgggaggta
cctcgagagaagatcaccctcctccgagagctggggcagggatccttcggtatggtgtac
gaaggcaatgccaaggatatcatcaagggtgaggtagagacccgtgttgcggtgaagacg
gtcaatgagtcagccagtcttcgagaacggatcgagttcctcaatgaggcatcagtcatg
aagggcttcacctgtcatcacgtggtccgccttcttggggtggtgtccaaaggccagccc
acattggtagtgatggaactgatggctcatggagacctgaaaagtcacctccgttctctg
cggcccgatgctgagaacaacccaggccgtcctccccctaccttgcaagaaatgattcag
atgacagcagaaattgccgatggcatggcatacttgaacgccaagaagtttgtgcaccgg
gacctggcagctcggaactgcatggttgcccatgattttactgtcaaaatcggagacttt
ggaatgacgagagacatctacgagacagattactatcggaaagggggcaaggggttgctg
cccgtgaggtggatgtcacccgagtccctgaaggacggagtcttcactgcttcttccgac
atgtggtcctttggggtggtcctttgggaaatcaccagcctggctgagcaaccttaccaa
ggcctgtctaatgaacaggtgttgaaatttgtcatggatggaggctatctggatccccct
gataactgtccagagagactcactgacctgatgcgcatgtgctggcagttcaaccccaag
atgaggccgaccttcctggaaatcgtcaacctgctcaaggacgacctccaccccagcttt
ccggaagtttccttcttctacagcgaggagaacaaggctcccgagagtgaagagctggag
atggagttcgaggacatggagaatgtccccttggatcgttcctctcactgtcagagagaa
gaggctggatgccgggagggagggtcctctctgagcatcaaacggacctatgatgaacac
atcccctacacccacatgaacgggggcaagaagaatgggcgggtcctcaccctgccgagg
tcgaacccttcctaa

DBGET integrated database retrieval system