KEGG   Rattus norvegicus (rat): 25055
Entry
25055             CDS       T01003                                 

Gene name
Lipa
Definition
(RefSeq) lysosomal acid lipase/cholesteryl ester hydrolase precursor
  KO
K01052  lysosomal acid lipase/cholesteryl ester hydrolase [EC:3.1.1.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00100  Steroid biosynthesis
rno04142  Lysosome
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    25055 (Lipa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25055 (Lipa)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    25055 (Lipa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.13  sterol esterase
     25055 (Lipa)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydro_lipase Hydrolase_4 DUF779 DUF900 LIDHydrolase
Other DBs
NCBI-GeneID: 25055
NCBI-ProteinID: NP_036864
RGD: 3008
Ensembl: ENSRNOG00000019077
UniProt: Q6IMY6
Position
1
AA seq 397 aa
MQLLGRVICFVVGILLSGGPTGTISAVDPEANMNVTEIIMHWGYPGEEHSVQTGDGYILG
VHRIPHGRKNQFDKGPKPVVYLQHGFLADSSNWVTNIDNNSLGFILADAGFDVWMGNSRG
NTWSRKHKTLSVSQDEYWAFSFDEMAKYDLPASINYILNKTGQEQLYYVGHSQGCTIGFI
AFSQMPELAKKVKMFFALAPVLSLNFASGPMVKLGRLPDLLLEDLFGQKQFLPQSAMVKW
LSTHICTHVIMKELCANIFFLICGFNEKNLNMSRVDVYTTHCPAGTSVQNMVHWTQVVKY
HKLQAFDWGSSDKNYFHYNQSYPPLYSIKDMQLPTALWSGGKDWLADTSDINILLTEIPT
LVYHKNIPEWDHLDFIWGLDAPWRLYNEVVSLMKKYQ
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgcaactgctaggccgggtgatctgtttcgtcgttgggatcctgctttctgggggccca
acggggaccatatcagctgtggaccctgaagcaaacatgaatgtgactgagataatcatg
cactggggatatcctggcgaagagcactcagtacagacaggagatggctacattctgggt
gttcaccgaatcccgcatgggcggaagaaccagtttgataaaggtcccaaaccagttgtg
tatcttcagcatggcttcctggcagattctagtaactgggtcacaaacattgacaacaac
agcctgggcttcatcctggcagatgctggctttgatgtgtggatgggaaacagcagagga
aacacctggtctcggaagcacaagactctgtcagtttctcaggatgaatactgggccttc
agttttgatgagatggcaaaatatgacctccctgcttcaattaactacattttgaataaa
actggccaagaacagctgtattatgtgggccactctcaaggctgcaccataggttttata
gcattttcacagatgcctgaactggcaaagaaggttaaaatgttttttgccctggctcct
gtgttgtctctcaattttgcttcgggcccgatggtcaaattgggacggttgccggatctg
cttcttgaggacttgtttgggcagaagcaatttcttcctcagagtgcaatggtgaaatgg
ctaagcactcacatttgcacgcacgtcatcatgaaggagctttgcgccaacatcttcttt
ctgatatgtggcttcaatgagaagaatttaaacatgtctagagtggatgtgtatacaaca
cactgtcctgcgggaacctctgtgcaaaacatggtacactggacccaggttgttaaatac
cataagcttcaagcttttgactggggaagcagtgacaagaattattttcattacaatcag
agttatccacccttgtacagcataaaagacatgcaactacccactgctttatggagcggg
ggcaaggactggctggcagacaccagtgacatcaatatcttactgactgaaatccccacg
ttagtgtaccacaagaacattcccgagtgggaccatctggattttatctggggtttggat
gccccctggaggctgtataatgaagtagtcagtctaatgaagaaataccagtga

DBGET integrated database retrieval system