KEGG   Rattus norvegicus (rat): 25125Help
Entry
25125             CDS       T01003                                 

Gene name
Stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04217  Necroptosis
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04630  Jak-STAT signaling pathway
rno04659  Th17 cell differentiation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05321  Inflammatory bowel disease (IBD)
Module
rno_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    25125 (Stat3)
   04066 HIF-1 signaling pathway
    25125 (Stat3)
   04068 FoxO signaling pathway
    25125 (Stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25125 (Stat3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25125 (Stat3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    25125 (Stat3)
   04062 Chemokine signaling pathway
    25125 (Stat3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    25125 (Stat3)
   04917 Prolactin signaling pathway
    25125 (Stat3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    25125 (Stat3)
   05206 MicroRNAs in cancer
    25125 (Stat3)
   05205 Proteoglycans in cancer
    25125 (Stat3)
   05203 Viral carcinogenesis
    25125 (Stat3)
  09162 Cancers: Specific types
   05212 Pancreatic cancer
    25125 (Stat3)
   05221 Acute myeloid leukemia
    25125 (Stat3)
   05223 Non-small cell lung cancer
    25125 (Stat3)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    25125 (Stat3)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    25125 (Stat3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25125 (Stat3)
  09172 Infectious diseases: Viral
   05162 Measles
    25125 (Stat3)
   05161 Hepatitis B
    25125 (Stat3)
   05160 Hepatitis C
    25125 (Stat3)
   05163 Human cytomegalovirus infection
    25125 (Stat3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25125 (Stat3)
   05169 Epstein-Barr virus infection
    25125 (Stat3)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    25125 (Stat3)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25125 (Stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25125 (Stat3)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    25125 (Stat3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 E2R135 Syntaxin-6_N Fib_alpha
Motif
Other DBs
NCBI-GeneID: 25125
NCBI-ProteinID: NP_036879
RGD: 3772
Ensembl: ENSRNOG00000019742
UniProt: P52631
Position
10q31
AA seq 770 aa AA seqDB search
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtggaaccagctccagcagctggacacgcgctacctggagcagcttcatcag
ctgtacagcgatagcttccccatggagctgcggcagttcctggcgccttggattgagagc
caagattgggcatatgcagccagcaaagagtcacacgccactctggtgtttcataacctc
ttgggcgagatcgaccagcagtatagccgattcctgcaggagtccaatgtcctctatcag
cacaacctgcgaagaatcaagcagttcctgcagagcaggtatcttgagaagccaatggaa
attgcccggattgtggcccgatgcctgtgggaagagtctcgcctcctccagacggcagcc
acggcagcccagcaagggggccaggccaaccaccccacagctgccgtagtgacggagaag
cagcagatgctggaacagcatcttcaggatgtccggaagcgtgtgcaggatctagaacag
aaaatgaaagtggtggagaatctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtctgtgaccagacagaagatg
cagcagctggagcagatgctcacggccctggaccagatgcggaggagcatcgtgagcgag
ctggcagggctcttgtcagcaatggagtacgtgcagaagacactgaccgatgaagagctg
gctgactggaagaggcggcagcagatagcgtgcatcggaggccctcccaacatctgcctg
gaccgtctggaaaactggataacttcattagcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaagtgtcctacaagggggaccctattgtgcag
caccggccaatgctggaggagaggatcgtggatctgttcagaaacttaatgaagagtgcc
ttcgtggtggagcggcagccctgtatgcccatgcacccggaccggcccttagtcatcaag
actggtgtccagtttaccacaaaagtcaggttgctggtcaaatttcctgagttgaattat
cagcttaaaattaaagtgtgcattgataaggactctggggatgttgctgccctcagaggg
tctcggaaatttaacattctgggcacgaacacaaaggtgatgaacatggaggagtccaac
aacggcagcctgtctgcagagttcaagcacctgaccctgagggagcagagatgtgggaat
gggggccgtgccaattgtgatgcctccttgattgtcactgaggagctgcacctgatcacc
tttgagacagaggtgtaccaccaaggtctcaagatcgacctagagacccactccttgcca
gtcgtggtgatctccaacatctgtcagatgcctaatgcttgggcatcaatcctgtggtat
aacatgctgaccaataaccccaagaacgtgaacttcttcactaagcctccgattggaacc
tgggaccaagtggccgaggtgctgagctggcagttctcgtccaccaccaagcgagggctg
agcatcgagcagctgaccacgctggccgagaagctcttagggcctggtgtgaactactca
gggtgtcagatcacatgggctaagttttgcaaagaaaacatggccggcaagggcttctcg
ttctgggtctggctagacaatatcatcgaccttgtgaaaaagtatatcttggccctttgg
aatgaagggtacatcatgggtttcatcagcaaggagcgggagagggccatcctaagcaca
aagcccccgggcaccttcctgctgcggttcagtgagagcagcaaggaaggaggggtcact
ttcacttgggtggaaaaggacatcagtggcaagacccagatccagtctgtagaaccatat
accaagcagcagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gacgctaccaacatcctggtatccccactggtctacctctaccctgacattcccaaggag
gaggcattcggaaagtattgtcgccccgagagccaggagcaccctgaagctgacccaggt
agtgctgccccttacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataac
ggggaaggcgctgagccctcagcaggagggcagtttgagtcgctcacgtttgacatggat
ctgacctcggagtgtgctacctccccgatgtga

DBGET integrated database retrieval system