KEGG   Rattus norvegicus (rat): 25150Help
Entry
25150             CDS       T01003                                 

Gene name
Fyn
Definition
(RefSeq) FYN proto-oncogene, Src family tyrosine kinase
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04360  Axon guidance
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04520  Adherens junction
rno04611  Platelet activation
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04725  Cholinergic synapse
rno05020  Prion diseases
rno05162  Measles
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    25150 (Fyn)
   04071 Sphingolipid signaling pathway
    25150 (Fyn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25150 (Fyn)
   04520 Adherens junction
    25150 (Fyn)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25150 (Fyn)
   04650 Natural killer cell mediated cytotoxicity
    25150 (Fyn)
   04660 T cell receptor signaling pathway
    25150 (Fyn)
   04664 Fc epsilon RI signaling pathway
    25150 (Fyn)
  09156 Nervous system
   04725 Cholinergic synapse
    25150 (Fyn)
  09158 Development
   04360 Axon guidance
    25150 (Fyn)
   04380 Osteoclast differentiation
    25150 (Fyn)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05020 Prion diseases
    25150 (Fyn)
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    25150 (Fyn)
  09172 Infectious diseases: Viral
   05162 Measles
    25150 (Fyn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25150 (Fyn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25150 (Fyn)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25150 (Fyn)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   25150 (Fyn)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    25150 (Fyn)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    25150 (Fyn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3
Motif
Other DBs
NCBI-GeneID: 25150
NCBI-ProteinID: NP_036887
RGD: 2641
Ensembl: ENSRNOG00000000596
Vega: OTTRNOG00000000110
UniProt: Q62844
Position
20q12
AA seq 537 aa AA seqDB search
MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcagcgaaactgacggaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggtgtgacctccatcccgaactacaacaacttccacgcagccgggggccaggga
ctcacggtctttgggggtgtgaactcctcctctcacaccgggaccctgcgtactagagga
gggacaggagtgacactatttgtggcactttatgactatgaagcacggacagaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagactggtgg
gaagcccgctccttgacaactggggaaactggttacattcctagcaactacgtggctcca
gttgactccatccaggcagaagagtggtactttggaaaacttggccgcaaggatgctgag
agacagctcctgtcctttggaaacccaagaggtacctttcttatccgcgagagcgaaacc
accaaaggtgcctactccctctccatccgagactgggacgacatgaagggagaccatgtc
aaacattacaaaatccgcaagcttgacaacggcgggtactacatcaccacgagggcccag
tttgagacccttcagcagcttgtacagcattactcagagagagccgcgggtctctgctgc
cgtctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaagccaggcacaatgtccccggaatccttcctggaggaagcacagatcatgaagaag
ctgaagcacgacaagctggtgcagctctatgcagttgtgtccgaagagcccatttacatt
gtcacggaatacatgaacaaaggaagtttgctcgacttcttaaaagacggtgaaggacgg
gctctgaaattgccaaacctcgtggacatggcggcacaggttgctgcaggaatggcttac
atcgaacgcatgaattatatccacagagatctgcggtcagctaacattctggtggggaac
ggactcatttgcaagattgctgacttcggattggcccggttgattgaagacaatgagtac
acagccagacaaggtgcaaagtttcccattaagtggacagcccccgaagcggccctgtat
ggaaggttcacaatcaagtctgacgtgtggtcctttggaatcttactcacagagctggtc
accaaaggcagagtgccgtacccaggcatgaacaaccgtgaggtgctggagcaggtggag
agaggctacaggatgccctgcccgcaggactgcccgatctccctgcacgagctcatgatc
cactgctggaaaaaggatccggaggagcgccccactttcgagtacttgcagggcttcctg
gaggactactttaccgccacagagccccagtatcagcccggtgaaaacctgtga

DBGET integrated database retrieval system