KEGG   Rattus norvegicus (rat): 25164
Entry
25164             CDS       T01003                                 

Gene name
Cdkn2b, p15
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2B
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
rno04934  Cushing syndrome
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25164 (Cdkn2b)
   04068 FoxO signaling pathway
    25164 (Cdkn2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25164 (Cdkn2b)
   04218 Cellular senescence
    25164 (Cdkn2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25164 (Cdkn2b)
   05203 Viral carcinogenesis
    25164 (Cdkn2b)
  09162 Cancer: specific types
   05226 Gastric cancer
    25164 (Cdkn2b)
   05222 Small cell lung cancer
    25164 (Cdkn2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25164 (Cdkn2b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25164 (Cdkn2b)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 25164
NCBI-ProteinID: NP_570825
RGD: 2324
Ensembl: ENSRNOG00000006735
UniProt: P55272
Position
5q32
AA seq 130 aa
MLGGGSDAGLATAAARGQVETVRQLLEAGADPNAVNRFGRRPIQVMMMGSAQVAELLLLH
GAEPNCADPATLTRPVHDAAREGFLDTLMVLHKAGARLDVCDAWGRLPVDLAEEQGHRDI
ARYLHAATGD
NT seq 393 nt   +upstreamnt  +downstreamnt
atgttgggcggcggcagtgacgcgggcctggccaccgccgcggcgcggggacaggtggag
acggtgcggcagctcctggaagccggcgcagatcccaacgccgtcaaccgcttcgggagg
cgcccgatccaggtcatgatgatgggcagcgcccaggtggcagagctgttgctcctccac
ggagcagaacccaactgcgccgatcctgccaccctcaccagacctgtgcatgatgcagct
cgagagggcttcctggacacgctaatggtgctgcacaaggcaggggcacggctggatgtg
tgtgacgcctggggccgcctgccggtagacttagctgaagagcagggccaccgtgatatt
gcgaggtatctgcacgctgccactggagattga

DBGET integrated database retrieval system