KEGG   Rattus norvegicus (rat): 25197Help
Entry
25197             CDS       T01003                                 

Gene name
St6gal1, Siat1
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00514  Other types of O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    25197 (St6gal1)
   00514 Other types of O-glycan biosynthesis
    25197 (St6gal1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    25197 (St6gal1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     25197 (St6gal1)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   25197 (St6gal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 25197
NCBI-ProteinID: NP_001106815
RGD: 3676
Ensembl: ENSRNOG00000001823
UniProt: P13721 G3V680
Structure
PDB: 

Position
11q23
AA seq 403 aa AA seqDB search
MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVV
FSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYK
VSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQR
CAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRF
LKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWE
LWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSA
CTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattcataccaacttgaagaaaaagttcagcctcttcatcctggtctttctcctgttc
gcagtcatctgtgtttggaagaaagggagcgactatgaggcccttacactgcaagccaag
gaattccagatgcccaagagccaggagaaagtggccatggggtctgcttcccaggttgtg
ttctcaaacagcaagcaagaccctaaggaagacattccaatcctcagttaccacagggtc
acagccaaggtcaaaccacagccttccttccaggtgtgggacaaggactccacatactca
aaacttaaccccaggctgctgaagatctggagaaactatctgaacatgaacaaatataaa
gtatcctacaagggaccggggccaggagtcaagttcagcgtagaagcactgcgttgccac
cttcgagaccatgtgaacgtgtctatgatagaggccacagattttcccttcaacaccact
gagtgggagggttacctgcccaaggagaactttagaaccaaggttgggccttggcaaagg
tgtgccgtcgtctcttctgcaggatctctgaaaaactcccagcttggtcgagagattgat
aatcatgatgcagttctgaggtttaatggggcccctaccgacaacttccaacaggatgtg
ggctcaaaaactaccattcgcctaatgaactctcagttagtcaccacagaaaagcgcttc
ctcaaggacagtttgtacaccgaaggaatcctaattgtatgggacccatccgtgtatcat
gcagatatcccaaagtggtatcagaaaccagactacaatttcttcgaaacctataagagt
taccgaaggctgaaccccagccagccattttatatcctcaagccccagatgccatgggaa
ctgtgggacatcattcaggaaatctctgcagatctgattcagccaaatcccccatcctcc
ggcatgctgggtatcatcatcatgatgacgctgtgtgaccaggtagatatttacgagttc
ctcccatccaagcgcaagacggacgtgtgctattatcaccaaaagttctttgacagcgct
tgcacgatgggtgcctaccacccgctcctcttcgagaagaatatggtgaagcatctcaat
gagggaacagatgaagacatttatttgtttgggaaagccaccctttctggcttccggaac
attcgttgttga

DBGET integrated database retrieval system