KEGG   Rattus norvegicus (rat): 25217
Entry
25217             CDS       T01003                                 

Gene name
Tapbp
Definition
(RefSeq) tapasin precursor
  KO
K08058  TAP binding protein (tapasin)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno05163  Human cytomegalovirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    25217 (Tapbp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25217 (Tapbp)
   05168 Herpes simplex virus 1 infection
    25217 (Tapbp)
   05163 Human cytomegalovirus infection
    25217 (Tapbp)
   05169 Epstein-Barr virus infection
    25217 (Tapbp)
SSDB
Motif
Pfam: C1-set Ig_3 ig Med5
Other DBs
NCBI-GeneID: 25217
NCBI-ProteinID: NP_149089
RGD: 3819
Ensembl: ENSRNOG00000029500
Vega: OTTRNOG00000001945
UniProt: Q99JC6
Position
20
AA seq 464 aa
MKLLPLLVVVALGLATVVVSAGPQTIECWFVEDAGGGGLSKKPATLLLRHGPRGPPPRPD
LDPKLYFKVDDPAGMLLAAFRRYPAGAHAPHCEMSSYIPFPASAKWARGLSPQQNCSRAL
DGDWLMVSVSGTVFSLSSLLRPLPEPQREPVFITMATVVLTVLTRHPAPRIHLGKDAVLD
LRFAYAPPALEDAPSVASGPPPFGLEWRRQHRGKGHLLLAAIPGLLEKMPPAREKAVAFA
AWDDDNDPWGPWTGNGTLWLPAVSPSQEGVYLATVHLPYLQGQVSLELTVHKPPRVSLTP
APIVWAAPGEAPPELLCLVSHFYPEEGLEVEWELRGGPEGSSRKAEGKTWVSTVRHHSDG
SVSQSGHLQLPPVTDKQHGVRYACRVRHPSLPSSGRSAEVTLEVAGFSGPSIEDGIGLFL
SAFLLLGLFKALGWMAAYLTIPKILKEKASATSLTVPKDEKKSE
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaagcttcttcccctgctcgtcgttgtggcactgggcctggcgaccgtggtggtctcg
gctggaccacagacgattgagtgctggttcgtggaggatgcaggtgggggtggcctgtcc
aagaaacctgccacattgctactgcgccatggacccaggggaccgccgccccggccagat
cttgaccctaagctatacttcaaggtggatgacccggcgggaatgctcctggctgccttc
aggcggtaccccgcaggcgcccacgccccacactgcgagatgagcagctacatcccgttc
cccgcctcggcgaagtgggctaggggtctgagtccgcagcagaactgctcgcgggccctg
gacggggattggctgatggtcagcgtatccggcacggtcttcagcctctccagcctgctg
cgaccactgccggagcctcagcgggagcctgtcttcatcaccatggcaacagtggtactg
actgtcctcacacgtcaccccgcccctcggatccatctgggaaaggatgcagtgctggac
ctgcgttttgcctacgcgccccctgctctggaagatgctccctctgtggcctcagggcct
cctccctttgggctggagtggcggcgccagcacaggggaaagggtcacctgctgctggct
gcaattcctgggctgcttgagaaaatgccaccagcccgagaaaaggctgtggcatttgct
gcttgggatgacgacaatgatccctggggcccgtggactgggaatgggaccttgtggctg
ccagcagtgagcccttctcaggagggtgtctacctggccaccgtacatctgccctatctg
caaggacaggtgtccctggagctgactgtgcacaagcccccgagagtgtctctaacacca
gcacccattgtgtgggctgccccaggagaggcacccccagaattgctctgtcttgtgtcc
cacttctaccctgaggagggcttggaggtggaatgggagctcagaggtggcccagaagga
agttctagaaaggctgaggggaagacttgggtctccactgtccgtcaccattctgatggc
tctgtcagccagtctgggcacctgcagctacccccagtcactgacaagcaacatggagtt
cgctatgcctgtcgggtccgccaccctagcctgccctcatcggggcgcagtgctgaagtc
actctggaggtggcaggcttctcagggccctccattgaggacggcataggcctcttcctg
tctgcttttctccttttgggcctcttcaaggcactaggctggatggctgcctacctgacc
attcctaaaatcttaaaggagaaggcctcagctaccagcctgaccgttcccaaagacgaa
aagaagtcagagtga

DBGET integrated database retrieval system