KEGG   Rattus norvegicus (rat): 25261
Entry
25261             CDS       T01003                                 

Gene name
Id1
Definition
(RefSeq) DNA-binding protein inhibitor ID-1
  KO
K04680  DNA-binding protein inhibitor ID1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25261 (Id1)
   04350 TGF-beta signaling pathway
    25261 (Id1)
   04390 Hippo signaling pathway
    25261 (Id1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25261 (Id1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25261 (Id1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    25261 (Id1)
SSDB
Motif
Pfam: HLH Dsl1_N
Other DBs
NCBI-GeneID: 25261
NCBI-ProteinID: NP_036929
RGD: 2858
Ensembl: ENSRNOG00000021750
UniProt: P41135 A0JPJ2
Position
3
AA seq 148 aa
MKVASSSAAATAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLY
DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVATAGGRGLPVRA
PLSTLNGEISALAAEAACVPADDRILCR
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaggtcgccagtagcagtgccgcggccaccgcaggccccagctgttcgctgaaggca
ggcaggacggcgggcgaagtggtgcttggtctgtcggagcaaagcgttgccatctcgcgc
tgcgctgggacgcgcctgcccgccttgctggacgaacagcaggtgaacgttctgctctac
gacatgaacggctgctactcacgcctcaaggagctggtgcctaccctgcctcagaaccgc
aaagtgagcaaggtggagatactgcagcatgttatcgactacatcagggacctgcagctg
gagctgaactctgagtctgaagtcgcgaccgccggaggccgggggctgcccgtccgggcc
ccgctcagcaccctgaacggcgagatcagtgccttggcggccgaggcggcatgtgttcca
gccgacgaccgcatcttgtgtcgctga

DBGET integrated database retrieval system