KEGG   Rattus norvegicus (rat): 25287
Entry
25287             CDS       T01003                                 

Gene name
Acadl, ACOADA, LCAD
Definition
(RefSeq) acyl-CoA dehydrogenase, long chain
  KO
K00255  long-chain-acyl-CoA dehydrogenase [EC:1.3.8.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
Module
rno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    25287 (Acadl)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    25287 (Acadl)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.8  long-chain acyl-CoA dehydrogenase
     25287 (Acadl)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N
Other DBs
NCBI-GeneID: 25287
NCBI-ProteinID: NP_036951
RGD: 2011
Ensembl: ENSRNOG00000012966
UniProt: P15650
Position
9q32
AA seq 430 aa
MAARLLLRSLRVLSARSATLPPPSARCSHSGAEARLETPSAKKLTDIGIRRIFSSEHDIF
RESVRKFFQEEVIPYHEEWEKAGEVSRELWEKAGKQGLLGINIAEKHGGIGGDLLSTAVT
WEEQAYSNCTGPGFSLHSDIVMPYIANYGTKEQIEQFIPQMTAGKCIGAIAMTEPGAGSD
LQGVRTNAKRSGSDWILNGSKVFITNGWLSDLVIVVAVTNREARSPAHGISLFLVENGMK
GFIKGKKLHKMGMKAQDTAELFFEDVRLPASALLGEENKGFYYLMQELPQERLLIADLAI
SACEFMFEETRNYVRQRKAFGKTVAHIQTVQHKLAELKTNICVTRAFVDSCLQLHETKRL
DSASASMAKYWASELQNTVAYQCVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKE
LIARQIVSDS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggctgcgcgcctgctcctccgctcccttcgtgtcctgagcgcccgctcggcgacactc
ccgccgccctccgcccgatgttctcattctggagcagaagcacgtctagaaactccttct
gctaaaaaattaactgatattggaatcagaagaatcttttcctcagagcatgacattttc
cgggagagtgtaaggaagttttttcaagaagaagtgattccctaccacgaagaatgggag
aaagccggagaagtgagtagagagctctgggaaaaagctggcaagcaaggcctgcttggc
atcaacattgcagagaaacatggcggcatcggtggggacttgttgtcaacagcagttact
tgggaagagcaagcatactcaaattgcacaggccctggtttcagcctccattcagatatt
gtcatgccctatattgcaaattacggcacaaaagaacagatcgagcagtttatcccccag
atgacggcgggcaagtgtattggtgccatagccatgacagagcctggggctggaagtgac
ttacaaggagtaagaacaaatgccaaaaggtctgggagtgattggattctcaatggaagc
aaggtgttcatcactaatggctggttaagtgatctcgtgatcgtagtggccgtcaccaat
cgtgaagctcgatcgcccgctcatggcattagcctctttttggtggagaatggaatgaaa
ggatttattaagggcaagaagctacataagatgggaatgaaagcccaggacacagcagaa
ctattctttgaagatgttcgattgccagctagtgccctacttggggaagagaataaaggc
ttctactacctcatgcaagagctcccacaggaaaggcttttaattgctgatttggcaatt
tctgcctgtgagttcatgtttgaagaaaccaggaactacgtgagacaaagaaaggctttt
ggaaaaacagtcgcacacatccagactgtgcagcacaaactagcagaattgaagacgaac
atatgtgttaccagagcttttgtggacagctgcctacagctgcatgaaaccaaacgtctg
gactccgcctccgcttccatggcgaaatattgggcatctgaattacaaaacactgtagct
tatcagtgtgttcaactccatggaggctggggttacatgtgggaatacccgattgcaaaa
gcctacgtggatgctcgagttcagccgatctacggtggtaccaacgaaatcatgaaagag
ctgatcgcaagacagatcgtcagtgacagctag

DBGET integrated database retrieval system