KEGG   Rattus norvegicus (rat): 252920
Entry
252920            CDS       T01003                                 

Gene name
Olfm3
Definition
(RefSeq) olfactomedin 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: OLF Noelin-1 Dynactin_p22 Baculo_PEP_C Helo_like_N
Other DBs
NCBI-GeneID: 252920
NCBI-ProteinID: NP_665720
RGD: 628672
Ensembl: ENSRNOG00000017969
UniProt: P63057
Position
2q41
AA seq 478 aa
MSAPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSAPDTLTQISPKEGWQVYSSAQD
PDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQ
MKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNL
SSVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGA
WMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
SLYFNKYQSNIIIKYSFDLGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVY
ATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSY
STKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagtgctccactgctgaagctgggcgctgtgctcagcaccatggcaatgatctcaaac
tggatgtcccaaactctcccatcccttgtaggactgaacaccacaaggctgtcggcgcca
gataccttaactcagattagccccaaagaagggtggcaagtgtacagctcagcacaggac
cccgatggacgatgcatttgtactgtggtggctccagaacaaaacctgtgttccagagat
gccaaaagcaggcagctccgccagctactggaaaaggtacagaatatgtcccagtctata
gaagtcttaaacttgagaactcagagagattttcaatacgtcttaaagatggaaacccaa
atgaaagggctgaaggccaagtttcggcagattgaagatgatcggaagacgctaatgacc
aagcattttcaagagttgaaagagaaaatggacgagctactgcccctcatcccagtgttg
gagcagtacaaaaccgacgcaaagctcatcacgcagttcaaggaggaaatccggaacctg
tcttcagtcctcactgggattcaggaggaaatcggtgcctatgactatgaagaactgcac
caacgggtcctcagcttagaaactaggcttcgtgactgcatgaaaaagctaacgtgtggc
aaactgatgaaaataacaggccccatcacagtcaagacatctggaactcgatttggtgct
tggatgactgatcctttagcatcagaaaagaataacagagtctggtacatggacagttac
actaacaataaaatagttcgtgagtacaagtccattgcagactttgttagtggagctgaa
tcaaggacatacaacctccctttcaagtgggcaggaactaaccacgtggtctacaatggc
tccctctactttaacaagtatcaaagtaatatcatcatcaagtacagctttgatttaggg
agagtgctagcccaaagaagcctggagtatgctggttttcacaatgtgtacccctacacg
tggggtggattctccgacattgacctaatggctgatgaaattgggctgtgggctgtatat
gcaactaaccagaatgcaggcaatattgtcatcagccagcttaatcaagataccttggag
gtgatgaagagctggagcactggctatcccaagagaagtgcaggggaatccttcatgatc
tgtgggactctgtatgtcaccaattcccacttaacaggagccaaagtgtattattcctat
tccacaaaaacctccacatatgagtacacagacatccccttccataaccaatactttcac
atatctatgcttgactacaatgcaagagatagagctctttatgcctggaacaatggccac
caagtcctattcaatgttaccctgttccacatcattaagactgaagatgacacatag

DBGET integrated database retrieval system