KEGG   Rattus norvegicus (rat): 252929
Entry
252929            CDS       T01003                                 

Symbol
Ctsz
Name
(RefSeq) cathepsin Z precursor
  KO
K08568  cathepsin X [EC:3.4.18.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    252929 (Ctsz)
  09143 Cell growth and death
   04210 Apoptosis
    252929 (Ctsz)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    252929 (Ctsz)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.18  Cysteine-type carboxypeptidases
    3.4.18.1  cathepsin X
     252929 (Ctsz)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   252929 (Ctsz)
SSDB
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Other DBs
NCBI-GeneID: 252929
NCBI-ProteinID: NP_899159
RGD: 708479
Ensembl: ENSRNOG00000050697
UniProt: Q9R1T3
Position
3
AA seq 306 aa
MASSGSVQQLRLVLLMLLLAGAARASLYFRPGQTCYRPLHRDHLALLGRRTYPRPHEYLS
PADLPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLL
SVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFKE
CHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERMSNYTGGIYTEYQNQAI
INHIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAIEEACT
FGDPIV
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcgtcgtcgggatcggtgcagcagctgcggctggtgctgctgatgttgctgctggcc
ggtgcggcacgggccagcctctacttccgcccgggccagacctgctaccgaccccttcac
agggaccacctggctctgctggggcgcaggacctatcctcggccacatgagtacctgtcc
ccagcggatctccccaagaactgggactggaggaatgtgaacggtgtcaactatgccagc
gtcacgaggaatcagcatatcccacagtactgtggttcttgctgggcccacggcagcacc
agtgccttggcagatcgcatcaacatcaagagaaaaggtgcatggccctccaccctgttg
tcggtgcagaatgtcatcgactgcggcaatgctggttcttgtgaggggggcaatgacctt
ccggtgtgggagtatgcccacaagcatggcatccccgatgagacctgcaacaactaccag
gccaaggaccaagaatgtgacaagtttaaccagtgtgggacctgcactgaattcaaagag
tgccacaccatccagaattataccctctggagagtgggtgactatggctccctgtccggg
agggagaagatgatggcagagatctacgccaatggtcccatcagctgcgggataatggca
accgagaggatgtctaactacactggaggcatctatactgagtaccagaaccaggccatt
atcaaccacatcatctctgtagccggctggggtgtcagcaatgatggcatcgagtattgg
attgtccgcaattcatggggcgagccctggggtgagcgaggctggatgagaattgtgacc
agcacctataagggagggacaggttccagctacaacctcgccattgaggaggcctgcaca
tttggggaccccattgtctag

DBGET integrated database retrieval system