KEGG   Rattus norvegicus (rat): 252961
Entry
252961            CDS       T01003                                 

Gene name
Tank
Definition
(RefSeq) TRAF family member-associated NF-kappa-B activator isoform 2
  KO
K12650  TRAF family member-associated NF-kappa-B activator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    252961 (Tank)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    252961 (Tank)
   04622 RIG-I-like receptor signaling pathway
    252961 (Tank)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    252961 (Tank)
   05022 Pathways of neurodegeneration - multiple diseases
    252961 (Tank)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    252961 (Tank)
SSDB
Motif
Pfam: TBD PspA_IM30 FliD_N OEP
Other DBs
NCBI-GeneID: 252961
NCBI-ProteinID: NP_001157545
RGD: 628859
Ensembl: ENSRNOG00000008859
UniProt: F1M101 Q5HZX1
Position
3
AA seq 413 aa
MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKTENYEQRIREQQEQLSFQQTLIDRLKS
QLRLVDSSRDNTCDYVPLLEDSDRRKNNLTLDEPHDKVKLGTLRDKQSKVRRQEVSSGKE
TSKDLSIPLHHERDNIEKTFWDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQ
CTDKTEKQEALFKPQAKDDINRGMSCVTSVTPRGLGRDEEDTSFESLSKFNVKFPPVDSD
STFLHSTPETPSILAPSTPEAVCQDKFNVEVRDSPGNLVKTEETLFEIQGINPITSAIQN
LKTTDKTKPSNLRAPCLPAGDHNVFYVNTFPLQDPPDAPFPSLDSPGKAVRGPQQPLWKP
FPNQDTDLVVPSGSDSVLLKPQVCEFCQELFPPSLTSRGDFLRHLNTHFNGET
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggataaaaacattggcgagcaactcaatagagcatatgaagccttccgacaggcatgc
atggatagagattcagcagtaagagagctgcagcagaagactgagaactatgaacaaaga
atacgcgagcaacaggaacagctgtcatttcaacaaactctcattgacaggctaaagtca
cagctacgtcttgtggattctagtcgagataacacttgtgactatgtacctttgcttgaa
gacagtgacagaaggaagaataatttgacccttgatgaaccacatgataaagtgaaacta
ggaacactgagagataagcaatcaaaggtgagaagacaagaagtttcttctggaaaagag
acctcaaaggatctcagcatccctttgcatcatgaaagggataatatagagaagactttc
tgggaccttaaagaagaatttcataggatatgcttactagcaaaagcacagaaagaccac
ttaagcaaacttaatataccagatattgcaactgacacacagtgttctgtgcctatacag
tgtaccgataaaacagaaaaacaagaagcgctgtttaagccccaggctaaagatgatata
aatagaggtatgtcgtgcgtcacatctgtcacaccaagaggactgggccgggatgaggaa
gatacctcttttgaatcgctttctaaattcaatgtcaagtttccgcctgtggacagtgac
tctacttttctacatagcactccagagaccccgagcatccttgctccctccacacctgag
gcagtgtgccaggacaagtttaatgtggaagtcagagacagcccaggaaacttggttaaa
acagaagaaactttatttgaaattcagggaattaaccccataacttcagctatacaaaac
cttaaaacaactgacaaaacaaaaccctcaaatcttagagctccgtgtttgccagctgga
gaccataatgtgttctatgtaaatacgttcccacttcaagacccgcctgacgcacctttt
ccctcactggattccccaggaaaggctgtccgaggaccacagcagcccctttggaagcct
tttcctaaccaagacactgacttagtggtaccaagtggttcagactcagtactccttaaa
cctcaagtgtgtgagttctgtcaagagcttttcccaccatcccttacatccagaggggat
ttcctccggcatcttaatacacactttaatggagagacttaa

DBGET integrated database retrieval system