KEGG   Rattus norvegicus (rat): 25330Help
Entry
25330             CDS       T01003                                 

Gene name
Lipe, HSL
Definition
(RefSeq) lipase E, hormone sensitive type
  KO
K07188  hormone-sensitive lipase [EC:3.1.1.79]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04152  AMPK signaling pathway
rno04371  Apelin signaling pathway
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    25330 (Lipe)
   04024 cAMP signaling pathway
    25330 (Lipe)
   04152 AMPK signaling pathway
    25330 (Lipe)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25330 (Lipe)
   04923 Regulation of lipolysis in adipocytes
    25330 (Lipe)
   04925 Aldosterone synthesis and secretion
    25330 (Lipe)
  09159 Environmental adaptation
   04714 Thermogenesis
    25330 (Lipe)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     25330 (Lipe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSL_N Abhydrolase_3 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 25330
NCBI-ProteinID: NP_036991
RGD: 3010
Ensembl: ENSRNOG00000020546
UniProt: P15304
Position
1q21
AA seq 1068 aa AA seqDB search
MKPRRPISFTREITAMEPSSTSVSRPEWRPEAQQTLTDYPGSRELQEFGIPQKQSLPNEA
TAQQGAEFQQEQGVQQSTLLQKLLTPLAFPVPQQSFPSHKVHSDQQEATSQNGPGAGKVH
TTQKELEHRDEHVGTAESGPAEPPPATEVEATSIAQAVSGPDKKLPTQTDLVSQERAEQS
DPTAQQTPLVQGVKSDQGSLIESGILARLQKLAIQQPSQEWKTFLDCVTESDMEKYLNSS
SKSNPPEPSGGTVIPGTLPSKQKPDCGKMSGYGGKLPHGKKGILQKHKHYWDTASAFSHS
MDLRTMTQSLVALAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHH
FDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRASHNLAELEAYLAALTQ
LRALAYYAQRLLTINRPGVLFFEGDEGLSADFLQDYVTLHKGCFYGRCLGFQFTPAIRPF
LQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKA
FWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSDPKLTVTISPPLAHTGPGPV
LARLISYDLREGQDSKMLNSLAKSEGPRLELRPRPQQAPRSRALVVHIHGGGFVAQTSKS
HEPYLKNWAQELGVPIISIDYSLAPEAPFPRALEECFFAYCWAVKHCELLGSTGERICLA
GDSAGGNLCITVSLRAAAYGVRVPDGIMAAYPVTTLQSSASPSRLLSLMDPLLPLSVLSK
CVSAYSGTETEDHFDSDQKALGVMGLVQRDTSLFLRDLRLGASSWLNSFLELSGRKPHKT
PLPATETLRPTDSGRLTESMRRSVSEAALAQPEGLLGTDSLKKLTIKDLSFKGNSEPSDS
PEMSQSMETLGPSTPSDVNFFLRSGNSQEEAETRDDISPMDGIPRVRAAFPDGFHPRRSS
QGVLHMPLYSSPIVKNPFMSPLLAPDVMLKTLPPVHLVACALDPMLDDSVMFARRLKDLG
QPVTLKVVEDLPHGFLSLAALCRETRQAAELCVQRIRLILTPPAAPLT
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctaggagaccaatttctttcacaagggaaataacagctatggagccaagttct
acctctgtgtctaggccagaatggagacctgaggcacagcagaccctcacagactaccca
ggatcaagggaactgcaggaatttggtatcccacagaaacaaagtctcccaaatgaggcc
actgcccagcaaggagctgaattccagcaagaacagggagttcaacaatctactctgctc
cagaaacttctcaccccattagccttccctgtaccacagcaatcattcccaagccacaaa
gtgcactcggatcaacaggaagccacctcccagaatggacctggggcggggaaagtgcat
acaactcaaaaggaactagaacacagagatgaacacgtggggacagcagaatctggacca
gcagaaccacctccagctacagaagtagaggctacatctatagcccaggccgtatctgga
ccggacaagaaactccctacccaaactgacttggtctcccaagagagagctgagcagtca
gaccctacagcccagcaaacacctctagtccaaggagtcaagtctgaccagggatctttg
atagagtcagggattttagcaagactgcagaaactagccatacagcagccctcccaagag
tggaagacatttcttgattgtgttacagagtctgacatggagaaatacctgaattcatcc
tcaaagtcaaaccctccagagccaagtggtgggacagtgatcccaggaacgctgccctcc
aaacagaaacccgattgtggaaagatgtcaggatatggtgggaaattaccacatgggaag
aaaggcatcctccagaaacacaagcactactgggatacagcctcggcattctcacacagc
atggatttacgcacaatgacacagtcgctggtggcgctcgcagaagacaacatggccttc
ttctcaagccagggcccaggagagacagcacggcggctgtccaacgtctttgcaggtgtt
cgggaacaggcactggggctagaaccaactctaggtcagctcttgggtgtggcacaccat
ttcgacctggacactgagacaccagccaacggataccgtagcttggtgcacacagctcgt
tgctgcctggcacacctactacacaaatcccgctatgtggcctctaaccgcagaagtatc
ttcttccgtgccagccacaacctagcagaactggaggcctacctggctgccctcacccag
ctccgtgctctagcctactacgcccagcgcctgctgaccatcaaccgaccaggagtgctc
ttctttgagggcgatgagggactcagcgctgacttcctacaggactatgtcacgctacat
aaaggctgcttttacggtcgctgcctgggcttccagttcacacctgccatccggccgttc
ctgcagactctctccatcgggctggtgtccttcggggaacactacaaacgcaacgagacg
ggcctcagtgtgactgcaagttccctctttacgggtggccgattcgccatagacccagag
ttgcgtggggctgaatttgagcgcatcatacagaacctggacgtgcacttctggaaagcc
ttctggaatatcacggagatcgaggtgctatcgtctctggccaacatggcatcaaccacc
gtgagggtaagccgcctgcttagcttgccgcctgaggcctttgagatgccactaacctct
gaccccaagctcacagttaccatctcacctcccttggcacacacgggaccaggccctgtg
ctagccaggctcatctcctatgacctgcgggaagggcaggacagcaagatgctcaacagc
ctggcaaaatctgagggcccacgcctggagctgcgcccacggcctcaacaagccccccgc
tcacgagccctggttgtccacattcacggtggtggctttgtggcacagacctccaaatcc
catgagccctacctcaagaactgggcccaggagctaggcgtccccatcatctccatcgac
tactccctggcccctgaggcccccttcccccgagcactggaggagtgtttttttgcctac
tgctgggctgtcaagcactgtgaactgcttggttcaaccggagagcggatatgccttgcg
ggggacagcgcaggtgggaacctctgcatcaccgtgtcccttcgggcagcagcctatggg
gtgagggtgccagatggcatcatggcagcctacccagttaccaccctgcagtcctctgct
tctccctctcgtctgctgagcctcatggatcctcttctaccactgagcgtactctccaag
tgtgtgagcgcctattcagggacagagacggaggaccattttgactcagaccagaaggca
ttgggcgtgatggggctggtgcagagagacacgtccctgttcctcagagacctccgcctg
ggcgcctcctcatggctcaactccttcctggagttaagtgggcgcaagccccataagacc
ccattgcctgcaacagagacactgcgccccacggattctgggcgccttacggagtctatg
cgcaggagtgtgtctgaggcagccctggcccagcctgagggcttgctgggcacagattcc
ttgaagaagctaacaataaaggacttgagctttaagggcaactcagagccatcagacagc
cccgagatgtcacagtcaatggagacacttggcccctccacaccctcggatgtcaacttt
tttctgcgatccgggaattcccaggaagaggctgaaaccagagatgatataagccccatg
gacggaatcccccgcgtgcgcgctgccttccctgatggtttccacccacggcgctcaagc
caaggtgtcctccacatgcccctctactcgtcacccatagtcaagaaccccttcatgtct
cctctgctggcccctgacgtcatgctgaagaccctgccgcccgtgcaccttgtggcgtgc
gctctggaccccatgctggatgactcggtcatgttcgcgcggcgactgaaggacctgggc
cagcccgtgacgctgaaagtggtagaggacctgccgcatggtttcctgagcttagcagcc
ctgtgtcgtgagacccggcaggccgcggagttgtgcgtgcagcgcatccggctgatcctc
accccccctgctgcaccgctgacctga

DBGET integrated database retrieval system