KEGG   Rattus norvegicus (rat): 25398Help
Entry
25398             CDS       T01003                                 

Gene name
Cacna1a, BccA1, Cav2.1, rbA-1
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04742  Taste transduction
rno04930  Type II diabetes mellitus
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    25398 (Cacna1a)
   04020 Calcium signaling pathway
    25398 (Cacna1a)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    25398 (Cacna1a)
   04727 GABAergic synapse
    25398 (Cacna1a)
   04725 Cholinergic synapse
    25398 (Cacna1a)
   04728 Dopaminergic synapse
    25398 (Cacna1a)
   04726 Serotonergic synapse
    25398 (Cacna1a)
   04730 Long-term depression
    25398 (Cacna1a)
   04723 Retrograde endocannabinoid signaling
    25398 (Cacna1a)
   04721 Synaptic vesicle cycle
    25398 (Cacna1a)
  Sensory system
   04742 Taste transduction
    25398 (Cacna1a)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    25398 (Cacna1a)
   05033 Nicotine addiction
    25398 (Cacna1a)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    25398 (Cacna1a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   25398 (Cacna1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel
Motif
Other DBs
NCBI-GeneID: 25398
NCBI-ProteinID: NP_037050
RGD: 2244
Ensembl: ENSRNOG00000052707
UniProt: P54282 O70368
Position
19q11
AA seq 2368 aa AA seqDB search
MARFGDEMPGRYGAGGGGSGPAAGVVVGAAGGRGAGGSRQGGQPGAQRMYKQSMAQRART
MALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALE
QHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIVALGFAFHKGSYLRNGWNVMDFVVVL
TGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAIL
IFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI
TQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGV
LSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDVEQRHPFD
GALRRATLKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRF
YIRRMVKTQAFYWTVLSLVALNTLWLAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKM
YGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWA
SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAI
MTVFQILTGEDWNEVMYDEIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLA
NAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQR
TSEMRKQNLLASREALYGDAAERWPTTYARPLRPDVKTHLDRPLVVDPQENRNNNTNKSR
APEALRQTARPRESARDPDARRAWPSSPERAPGREGPYGRESEPQQREHAPPREHVPWDA
DPERAKAGDAPRRHTHRPVAEGEPRRHRARRRPGDEPDDRPERRPRPRDATRPARAADGE
GDDGERKRRHRHGPPAHDDRERRHRRRKESQGSGVPMSGPNLSTTRPIQQDLGRQDLPLA
EDLDNMKNNKLATGEPASPHDSLGHSGLPPSPAKIGNSTNPGPALATNPQNAASRRTPNN
PGNPSNPGPPKTPENSLIVTNPSSTQPNSAKTARKPEHMAVEIPPACPPLNHTVVQVNKN
ANPDPLPKKEEEKKEEEEADPGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMC
ILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYF
RDLWNILDFIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDC
VVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFERDCRGKYLLYEKNEV
KARDREWKKYDFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSI
FYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMP
QNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLF
SLECVLKVMAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLI
KLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDGEDEDSDED
EFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGIQKPECGNEFAYF
YFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHY
KDMYSLLRVISPPLGLGKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKI
AKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQS
KAKKLQAMREEQNRTPLMFQRMEPPSPTQEGGPSQNALPSTQLDPGGGLMAQESSMKESP
SWVTQRAQEMFQKTGTWSPERGPPIDMPNSQPNSQSVEMREMGTDGYSDSEHYLPMEGQT
RAASMPRLPAENQRRRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEEN
QRYHQRRRDRGHRTSERSLGRYTDVDTGLGTDLSMTTQSGDLPSKDRDQDRGRPKDRKHR
PHHHHHHHHHHPPAPDRERYAQERPDTGRARAREQRWSRSPSEGREHATHRQGSSSVSGS
PAPSTSGTSTPRRGRRQLPQTPCTPRPLVSYSPAPRRPAARRMAGPPAPPGGSPRGCRRA
PRWPAHAPEGPRPRGADYTEPDSPREPPGGAHEPAPRSPRTPRAAGCASPRHGRRLPNGY
YAGHGAPRPRTARRGAHDAYSESEDDWC
NT seq 7107 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctttggagacgagatgccgggccgctacggcgcaggcggaggaggctcaggg
ccggccgccggggtggtcgtgggcgccgcgggcggccgaggagccgggggcagccggcag
ggcgggcagcccggagcgcagaggatgtacaagcagtcgatggcgcagagagcgcggacc
atggccctctacaaccccatccctgtccgccagaactgcctcacggtcaaccgctccctg
ttcctcttcagtgaagacaacgtggtgagaaaatacgccaaaaagatcacggaatggcct
cccttcgagtacatgatcctggccaccatcattgctaactgcatcgtcctggccctggag
cagcacctccctgatgatgacaagacacccatgtccgagcggctggatgacacagaaccc
tatttcattggcatcttctgttttgaggctggaattaagatcgtggctcttggctttgcc
ttccacaaaggctcctacctgaggaatggctggaacgtcatggactttgtcgtggtgcta
acaggcatcttggccactgtcgggacggagtttgatctacggacactgagggcggttcgt
gtgctgcggccactcaagctggtgtctggaatcccaagtttacaagtcgtcctgaagtca
atcatgaaggcgatgatccctctgctgcagatcggcctcctcctgttttttgcaatcctt
atttttgcaatcatagggttagaattttatatgggaaaatttcataccacctgctttgaa
gaggggacagacgacatccagggtgagtcgccagctccgtgtgggacagaggagcctgcc
cgcacctgccccaacgggaccaaatgtcagccgtactgggaagggcccaacaacggcatc
actcagttcgacaacatcctgtttgctgtgctcactgttttccagtgcatcaccatggaa
ggctggactgatctcctctacaatagcaacgatgcctcagggaacacttggaactggttg
tacttcatccccctcatcatcatcggctccttttttatgctgaaccttgtgctgggtgtg
ctgtctggggagtttgccaaagaaagggaacgtgtagagaaccgaagggcttttctgaag
ctcagaagacaacagcagattgaacgtgagctcaatggatacatggagtggatctcgaaa
gcagaagaggtgatcctcgcggaggacgagacagacgtggagcagaggcacccttttgat
ggagctcttcggagagctactctgaagaaaagcaagacggacctgctcaaccctgaggag
gcggaggaccagcttgctgacatcgcgtctgtggggtctcccttcgccagagccagcatc
aaaagtgccaagctggagaattcgacttttttccacaaaaaggagagaagaatgcgtttc
tacatccgccgcatggtcaaaactcaggccttctactggaccgtgctcagtctggtagcc
ctcaacacgctgtggctcgccattgtccactacaaccagcccgagtggctctccgacttc
ctctactatgcagaattcattttcttaggactctttatgtccgaaatgtttataaaaatg
tatgggctcgggacacggccttacttccactcttccttcaactgctttgactgtggggtc
atcatcgggagcatctttgaagtcatctgggccgtcatcaaaccgggtacatcctttgga
atcagcgtgttacgagctctcaggttactgcgtattttcaaagtcacaaagtactgggca
tctctcagaaacctggttgtctccctcctcaactccatgaaatccatcataagtctgctg
ttcctcctcttcctcttcattgtcgtctttgccctcttggggatgcagctgtttggtggc
cagtttaattttgacgaggggactcctcccaccaacttcgacacttttccagcagcaata
atgactgtgtttcagatcctgactggcgaggattggaatgaggtcatgtatgatgagatc
aagtctcaggggggcgtgcagggcggcatggtgttctccatctacttcatcgtcctcacc
ctcttcgggaactacaccctgctgaacgtgttcttagctatcgcggtggacaacctggcc
aacgcccaggaactcaccaaggatgaacaagaagaggaagaggcagccaatcagaaactg
gctctacagaaagccaaggaggtggcagaagtgagtcccctgtctgcagccaacatgtcc
atagctgtgaaggaacagcagaagaaccagaagcctgccaagtcggtgtgggagcagcgc
accagcgagatgcgcaagcagaacctgctggctagccgcgaggcgctgtacggggacgcg
gctgagcgctggcccaccacttacgcgcgcccgctgcggccggacgtgaagacgcacttg
gaccggccgctcgtggtggacccgcaggagaaccgtaacaacaacaccaacaagagccgt
gcgccagaagcgctgcgccaaaccgcgcggccccgcgagagcgcgcgcgaccccgacgcg
cggcgcgcctggcccagcagccctgagcgcgcccctggacgagagggcccgtatggccgc
gagagcgagccgcaacagcgcgagcacgcgccaccccgcgagcacgtaccctgggacgcg
gatcctgagcgcgccaaggccggggacgcgccccgccgccacacgcaccggcctgtggcc
gagggcgagcctcgtcgccaccgcgcgcgccgccggcccggggacgaaccggacgacaga
ccggagcgcaggccgcgtccccgcgacgccactaggccggcccgcgctgcagacggcgaa
ggcgatgatggggagcgcaagcggcgacaccgacacgggccgccggcccacgatgacagg
gagcgcagacaccggcgcagaaaagagagccagggctctggggtccccatgtctggtccc
aacctgtccaccaccaggccaatccagcaggatctgggccgccaggacctgccactggct
gaggacctggacaacatgaagaacaacaagttggccaccggggagcctgccagtccccac
gacagcctgggccacagtggccttccccctagccctgccaagatcgggaacagcaccaac
cctggtcccgccttggccaccaatccccagaatgctgccagccgcaggacgcccaacaac
ccgggcaacccgtccaaccccggcccccccaagactcccgagaacagccttatcgtcacc
aaccccagcagcacccagcccaactcagcaaagactgccaggaaacccgagcacatggcg
gtggagatccccccggcctgcccgcccctcaaccacactgtggtccaagtaaacaaaaac
gccaacccagacccactgccaaagaaagaggaagagaagaaggaggaagaggaggcagac
cccggggaggatggcccaaagcccatgccgccctacagctccatgttcatcctctccacc
accaacccccttcgccggctgtgccattacatcctgaacctgcgctacttcgagatgtgc
atcctcatggtcattgccatgagtagcatcgcgctggccgccgaggacccggtgcagccc
aacgcaccccgcaacaacgtgctgcgatattttgactatgttttcacaggagtgtttacc
tttgagatggtgatcaagatgatcgacctgggcctcgtcctgcatcagggggcctatttc
cgtgacctgtggaacattctggacttcatagtggtcagtggggccctggtggcctttgcc
ttcactggcaatagcaaaggaaaggacatcaacaccatcaagtccctccgagtcctccgg
gtgctacgacctctaaagaccatcaagcggctgcctaagttgaaggccgtatttgactgc
gtggtgaactcgctcaagaacgtcttcaacatcctcattgtctacatgctcttcatgttc
atcttcgccgtggtggccgtgcagctcttcaagggcaaattcttccactgcacggacgag
tccaaggagtttgagagagactgtcgaggcaaatacctcctttacgagaagaacgaggta
aaggcgcgggaccgcgagtggaagaaatacgacttccactacgacaacgtgctctgggcc
ctgctcacgctctttacggtgtccacgggagagggctggccacaggtcctcaagcactca
gtggatgccacttttgagaaccagggccccagccccgggtaccgcatggaaatgtccatc
ttctacgtggtctactttgtggtgtttcccttcttctttgtcaatatctttgtggccttg
atcatcatcaccttccaggagcagggagacaagatgatggaagaatacagcctagagaaa
aatgagagggcctgcatcgactttgccatcagtgccaagccgctgaccaggcacatgccc
cagaacaagcagagcttccagtatcgaatgtggcagttcgtggtgtccccaccctttgag
tacaccatcatggccatgatcgctctcaacaccatcgtgctaatgatgaagttctatgga
gcctctgtggcctatgaaaacgcccttcgagtgttcaacattgtcttcacctccctcttc
tctctcgaatgtgtgctcaaagtcatggcttttgggattctgaattatttccgcgatgcc
tggaacatcttcgactttgtgactgttctgggcagcatcacagacatcctcgtcaccgag
tttgggaataacttcatcaacctgagctttctccgcctcttccgtgctgcccgactcatc
aaactcctccgccagggttacaccatccgcattctcctctggactttcgtgcagtctttc
aaggccctaccttatgtctgtctgctgatcgccatgctcttcttcatctatgccatcatc
gggatgcaggtgtttggcaacatcggcattgatggggaagatgaggacagcgatgaggat
gagttccaaatcacggagcacaataacttccggaccttcttccaagctctcatgcttctc
ttccggagcgccacaggggaagcgtggcacaacatcatgctgtcctgcctcagcgggaag
ccatgcgacaagaactccgggatccaaaaaccagagtgtggcaacgagttcgcctatttt
tactttgtctcgttcatcttcctttgctcatttctgatgctgaatctctttgttgctgtc
atcatggacaacttcgagtacctcacccgagattcctccatcctgggcccccaccacctg
gatgagtacgtgcgtgtctgggcagagtatgaccctgctgcctgcggccgcattcactat
aaggacatgtacagtttattgcgagtaatatcgccccctctcggcttaggcaagaaatgt
cctcatagggttgcttgcaagaggctcttgcggatggacctacccgtagcggatgacaac
accgttcacttcaactccaccttgatggctctgatccgaaccgccctggatatcaaaatc
gcaaagggtggagctgacaagcagcaaatggacgcagagctccgcaaggaaatgatggcc
atttggcccaacctgtctcagaagaccttggatctgctggtcacacctcacaagtccacg
gacctgacagtgggtaagatctacgcagccatgatgatcatggagtactaccggcagagc
aaggccaagaagctgcaggccatgcgagaggagcagaaccggacaccactcatgttccag
cgcatggagcctccatcgccaacacaggagggaggacccagccaaaacgcccttccctcc
actcagctggaccccggaggaggcctgatggctcaagaaagcagcatgaaggagagcccg
tcctgggtgacccagcgggcacaggagatgttccagaagactggtacctggagcccagag
cgagggccacccatcgacatgcctaacagccagcccaactcccagtctgtggagatgaga
gaaatgggaactgatggctactcagacagcgaacactacctccccatggaaggacagacc
agggccgcctccatgccccgcctcccagcagagaaccagaggagaaggggccggccacgt
ggaaataacctcagtaccatctctgataccagccccatgaagcgctcagcctccgtgctg
ggacccaaagcccggcgactggatgactactcactagagcgggtaccacctgaggagaac
caaaggtaccaccaacgccgccgggaccgtggccaccgcacctctgagcgctctctgggc
cgatacactgatgtggacacaggcctggggacagatctgagcatgaccacccaatcgggt
gacctgccctccaaagatcgggaccaggaccggggccggcccaaggaccggaagcatcgg
ccacaccaccaccaccaccatcatcaccatcatcccccggccccggaccgggagcgctac
gcacaggagcggccggacaccggccgggcgcgggcccgggagcagcgctggtcccgctcg
cccagcgagggtcgggagcacgcgacacacagacagggcagtagttccgtcagtggaagc
ccagccccctctacgtccggcaccagcacgccgcggcgcggccgccgccagctcccccag
accccctgcaccccgcggccgcttgtgtcctactcgcccgctccgcgcaggcctgcggcg
cgcaggatggcgggtcccccagcgccccctggcggctcgccgcggggttgccgccgtgcg
ccgcgctggcctgcgcatgcgcctgagggcccgcggccgcgcggtgccgactacaccgag
cccgacagcccgcgcgagccgccagggggcgcgcatgagcccgcgccgcggtcgcccagg
actccgcgcgccgcgggctgcgcgtcaccgcgccacggccgcaggctgcccaatggttac
tacgcggggcacggcgcgccacggccgcgcacagcccgcaggggcgcgcacgacgcgtac
agcgagagcgaggacgactggtgctaa

DBGET integrated database retrieval system