KEGG   Rattus norvegicus (rat): 25412Help
Entry
25412             CDS       T01003                                 

Gene name
Col2a1, CG2A1A, COLLII
Definition
(RefSeq) collagen type II alpha 1 chain
  KO
K19719  collagen, type II, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04974  Protein digestion and absorption
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25412 (Col2a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25412 (Col2a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25412 (Col2a1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    25412 (Col2a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25412 (Col2a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25412 (Col2a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   25412 (Col2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI
Motif
Other DBs
NCBI-GeneID: 25412
NCBI-ProteinID: NP_037061
RGD: 2375
Ensembl: ENSRNOG00000058560
UniProt: P05539
Position
7q36
AA seq 1419 aa AA seqDB search
MIRLGAPQSLVLLTLLIATVLQCQGQDARKLGPKGQKGEPGDIKDIIGPKGPPGPQGPAG
EQGPRGDRGDKGERGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGGNFAAQMAGGFD
EKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPIGPRGPPGPA
GKPGDDGEAGKPGKAGERGLPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVK
GESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFL
GAPGAKGEAGPTGARGPEGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKGSAGAPGIA
GAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGETGPAGPQGAPGPAGEE
GKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDP
GRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPK
GANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPGPSGFQGLP
GPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTD
GPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLT
GPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAK
GDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPP
GSNGNPGPAGPPGPAGKDGPKGARGDTGAPGRAGDPGLQGPAGAPGEKGEPGDDGPSGSD
GPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLT
GPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAGPTGKQGDR
GEAGAQGPMGPSGPAGARGIAGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGPS
GDQGTSGPAGPSGPRGPPGPVGPSGKDGSNGIPGPIGPPGPRGRSGETGPAGPPGNPGPP
GPPGPPGPGIDMSAFAGLGQREKGPDPLQYMRADEADSTLRQHDVEVDATLKSLNNQIES
IRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGESCVYPNP
ATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQN
ITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKT
IIEYRSQKTSRLPIVDIAPMDIGGPDQEFGVDIGPVCFL
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcctcggggctccccagtcgctggtgctgctgacgctgctcatcgccacggtc
ctacaatgtcagggccaggatgcccgaaaattagggccaaaggggcagaaaggagaacct
ggagatatcaaagatatcataggacctaaaggacctcctggccctcagggacctgccggt
gaacaaggacccagaggtgaccgtggtgacaagggagagaggggtgcacctggaccccgt
ggcagagatggagaacctggtacccctggaaatcctggtccccctggccctccaggcccc
cctggtccccctggccttggtggaggaaactttgcagcccagatggctggaggatttgac
gagaaggctggtggtgcccagatgggagtcatgcaaggccccatgggccccatgggacct
cgtggacccccaggccccgccggtgcccccggccctcaaggatttcaaggcaatcctggt
gaacctggcgagcctggtgtctctggtcccattggtccccgaggtcctccaggtcctgct
ggaaaacctggtgatgatggtgaagctggaaagcccggaaaggccggagaaagaggcctc
cctggtcctcagggtgctcgtggattcccgggaacccccggtcttcctggtgtcaagggt
cacagaggttacccaggcctcgatggtgctaagggagaagctggtgctccaggtgtgaag
ggtgagagcggttcccctggtgagaacggatccccaggcccaatgggtccccgtggcctg
cctggcgagagaggacggactggccctgctggtgctgctggtgctcgaggcaacgacggc
cagccaggccctgctggacctccgggtcctgttggtcctgcaggtggtcctggcttcctt
ggtgctcctggtgccaagggcgaagctggtcccactggtgcccgtggtcctgaaggtgct
caaggttctcgtggcgaacccggcaatcccggatcccccgggcccgcaggcgcttctggt
aacccagggactgatggtattcccggagccaaaggatctgctggcgctcctggaattgct
ggtgcccctggcttccctgggccccgtggccctcccggtcctcaaggtgcaactggtcct
ctgggccccaaaggtcagacgggtgagcccggcatcgctggcttcaaaggtgaacaaggc
cccaagggagagactggacctgctgggccccagggagcccctggccctgctggtgaagaa
ggaaaacgaggtgctcgaggagagcccggtggcgctggacctatcggcccccctggagag
agaggtgctcctggcaaccgcggtttcccaggtcaagatggtctggcaggtcccaagggt
gcccctggagagcgagggcctagtggcctggctggtcctaagggtgccaatggtgacccg
ggtcgtcctggagaacctggtcttcctggagccaggggtcttactggccgccctggtgat
gctggtcctcaaggcaaagttggtccttctggagcccctggagaagacggtcgccctggt
cctcctggtcctcagggagctcgtgggcagcctggcgtcatgggtttccctggccccaaa
ggagccaatggcgagcctggcaaagctggtgagaaaggactggctggtgctcctggtctg
agaggtcttcctggcaaagatggtgagacaggagccgcaggaccccccggccccagcgga
cctgctggtgaacgaggcgagcagggtgctcctgggccatcagggttccagggacttcct
ggccctcctggtcccccgggtgaaggtggaaagcaaggtgaccagggtattcctggtgaa
gctggagcccctggcctcgttggtccccggggtgaacgaggtttcccaggtgaacgtggc
tctcccggtgctcagggcctccagggtccccgaggcctccctggcactcctggtactgat
ggtcccaaaggtgcggctggcccagatggtccccctggggctcagggccctccaggtcta
cagggaatgcctggtgagaggggagcagctggtattgctggacccaagggagacagaggt
gatgttggcgagaaaggcccagagggagctcctggaaaagatggtggccgaggtcttact
gggcccatcgggcccccaggaccagcaggtgccaatggcgagaagggagaagtcggacct
cctggtccttcaggaagtactggagctcgaggcgccccgggtgagcgcggagagactggg
ccacctggacctgctggattcgctggccctcctggtgctgatggccagcctggtgccaag
ggcgatcaaggagaagctggacagaaaggtgacgctggtgcccctggcccacaaggcccc
tcaggagctcccgggccacagggtcctactggagtgactggtcctaagggagcccggggc
gcccaaggcccaccgggagccaccggattccctggagctgctggccgagttggaccccca
ggttctaatggcaaccctgggcccgccggtccccctggtcctgctggaaaagatggtccc
aaaggtgctcgaggagacactggtgcccctggcagagctggtgaccctggacttcaagga
cccgcaggagctcctggagagaaaggcgaacctggagatgacggtccctctggttctgat
ggtcccccaggtccccaggggctggctggtcaaaggggcattgttggtctgcctggtcag
cgtggtgagagaggattcccaggccttcccggcccatcgggtgagcccggcaagcagggt
gcacctggtgcatctggagacagaggtcctcctggtcctgtggggcctcctggcttgaca
ggacctgcaggtgaacctggacgagagggcagccctggtgctgatggaccccctggcaga
gatggtgcggctggagtcaagggtgatcgtggtgagactggtgcacttggtgctcctgga
gctcctgggcccccaggctctcctggtcctgctggcccaactggcaaacaaggagacaga
ggagaggctggtgcacaaggtcctatgggcccctcaggacctgctggagcccgtggaatt
gctggccctcaaggcccccgaggtgacaaaggagaagctggagagcctggcgagagagga
ctgaaggggcaccgaggtttcactggactgcagggtctgcctggccccccgggtccttct
ggagatcagggtacttctggccctgctggtccttccggccctagaggtccacctggccct
gttggtccctctggcaaagatggctctaatggaatccctggccccatcgggcctccaggt
ccccgtggacgctcaggagaaactggccctgctggtcctcctggaaatcctggtccccct
ggccctccgggtcctcctggtcctggcatcgacatgtcagcctttgctggcttaggacag
agagagaagggccccgatcccctgcagtacatgcgggccgacgaggcagacagtaccttg
agacagcatgacgtcgaggtggacgccacgctcaagtcgctgaacaaccagatcgagagc
atccgcagccctgatggctcccgcaagaatcccgctcgcacctgccaggacctgaaactc
tgccacccagagtggaagagcggagactactggattgatcccaaccagggctgcaccttg
gacgccatgaaagtcttctgcaacatggagactggcgagtcttgcgtctaccccaaccca
gcgactgtgcctcggaagaactggtggagcagcaagagcaaggagaagaagcacatctgg
tttggagagaccatgaacggcggcttccacttcagctacggcgacggcaacctggctccc
aacaccgctaacgtccagatgactttcctccgtctactgtccactgagggctcccagaac
atcacctaccactgtaagaacagcattgcctacctggacgaagcagccggcaacctcaag
aaggccttgctcatccagggctccaatgatgtggagatgagggccgagggcaacagcagg
ttcacgtacactgccctgaaggatggctgcacgaaacacaccggtaagtggggcaagacc
atcatcgagtaccgatcacagaagacctcacgccttcccattgttgacattgcacccatg
gacatcggagggcctgatcaggaatttggtgtggacatagggcctgtctgtttcttgtaa

DBGET integrated database retrieval system