KEGG   Rattus norvegicus (rat): 25414
Entry
25414             CDS       T01003                                 

Gene name
Bcar1, Cas, Crkas, P130CAS
Definition
(RefSeq) BCAR1, Cas family scaffolding protein
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04510  Focal adhesion
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno04935  Growth hormone synthesis, secretion and action
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25414 (Bcar1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25414 (Bcar1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25414 (Bcar1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    25414 (Bcar1)
   04062 Chemokine signaling pathway
    25414 (Bcar1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    25414 (Bcar1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    25414 (Bcar1)
   05100 Bacterial invasion of epithelial cells
    25414 (Bcar1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25414 (Bcar1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 25414
NCBI-ProteinID: NP_037063
RGD: 2406
Ensembl: ENSRNOG00000019253
UniProt: Q63767
Structure
PDB: 
1Z23

Position
19q12
AA seq 968 aa
MKYLVSVGAGPARRAGGLEDVSWGPRVSRRPQSYRAARHVNESLPRSAFRVPAAHGASVT
PSAALGSGLPETQPEAVCRGTEKPRFAEGCKPAASRDKNVLAKALYDNVAESPDELSFRK
GDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAAPGPGPPATPPQPQ
PSLPQGVHTPVPPASQYSPMLPTAYQPQPDNVYLVPTPSKTQQGLYQAPGPNPQFQSPPA
KQTSTFSKQTPHHSFPSPATDLYQVPPGPGSPAQDIYQVPPSAGTGHDIYQVPPSLDTRS
WEGTKPPAKVVVPTRVGQGYVYEASQAEQDEYDTPRHLLAPGSQDIYDVPPVRGLLPNQY
GQEVYDTPPMAVKGPNGRDPLLDVYDVPPSVEKGLPPSNHHSVYDVPPSVSKDVPDGPLL
REETYDVPPAFAKPKPFDPTRHPLILAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPG
PGTLYDVPRERVLPPEVADGSVIDDGVYAVPPPAEREAPTDGKRLSASSTGSTRSSQSAS
SLEVVVPGREPLELEVAVETLARLQQGVSTTVAHLLDLVGSASGPGGWRSTSEPQEPPVQ
DLKAAVAAVHGAVHELLEFARSAVSSATHTSDRTLHAKLSRQLQKMEDVYQTLVVHGQVL
DSGRGGPGFTLDDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKAPGPGPEGSSSLH
LNPTDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKEL
LEKGNIVRQGKGQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLVPGRTGGLGPSDRQ
LLLFYLEQCEANLTTLTDAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQ
AKAADVRSKVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVDRVKELGHSTQQFRR
VLGQLAAA
NT seq 2907 nt   +upstreamnt  +downstreamnt
atgaagtacctggtgagtgtgggcgcggggccggccaggcgggcgggcggtctggaggac
gtttcctgggggccccgagtgtcccgccggccgcagagttaccgggcagctcggcacgta
aacgagtccctccctcggtccgcctttcgagtccccgcagctcacggagctagcgtgacg
ccctccgcagcccttgggtccgggttgcctgagactcagcccgaggcggtatgcagaggg
actgagaaaccgagatttgctgagggctgcaaaccggcggcgagccgcgacaagaacgtg
ctggccaaagccctctatgacaacgtagctgagtctccggatgaactctccttccgaaag
ggtgacatcatgacagtgctcgagcgggacactcagggcctggatggctggtggctctgc
tcactgcatgggcgccagggcattgtgcctggtaaccgcctcaagattctggttggcatg
tatgacaagaagccagcagcacctggaccaggcccacctgccaccccaccccagccccag
cccagccttccccagggcgtccatactccagtgcctccagcttcccagtacagtcccatg
ctccccactgcataccaaccccaacctgacaatgtgtacctggtacccactcccagcaag
actcagcaaggtctctaccaagcccctgggcccaacccacagttccagtcacccccagcc
aaacaaacatccacattctcaaagcaaacacctcatcactcatttcccagccctgccaca
gacctttaccaggtgcctccagggcctggaagtccagcccaggacatttaccaggtgcca
ccttccgctggcacagggcatgacatctaccaagtccctccatctttggacacccgcagc
tgggagggaacgaagccaccggcaaaggtggtggtacctactcgagtgggacagggctat
gtgtacgaggcctcccaggcagaacaggatgagtacgacaccccgcgccacctgctagct
ccaggttcccaggacatctatgatgtgccccctgttcgaggactgcttcccaaccagtat
ggccaggaggtatatgacaccccgcctatggcagtcaaaggccccaatggccgagacccg
ttgttggatgtgtatgacgtgccccctagtgtggagaaaggcctgccgccgtccaaccat
cattcggtgtatgatgttcctccttctgtgagcaaggatgtgcctgatggcccactgctg
cgtgaggaaacatatgatgtaccccctgccttcgccaaacccaagccttttgatccgacc
cgacatccattaatcctcgctgcacctcctccggactccccaccagctgaggatgtgtat
gatgtgccaccccctgctcctgacctctatgatgtgccccctggtttgcggcggcctggc
cctggaacactgtatgacgtgcctcgagagcgggtgctccctcctgaggtggctgatggg
agtgtaattgatgatggtgtgtatgctgtgcccccaccagccgagcgagaggcgccaaca
gatggcaagcgcctgtcggcctctagcacgggcagcacacgcagcagccaatcggcgtct
tccttggaggtagtggtgccaggtcgggagcccctggagctggaagttgctgtggagacc
ctggctcggctacagcagggtgtgagcaccaccgtagcccaccttctggacctggtgggc
agtgccagtggccccgggggctggcgtagtacctctgagccccaggagcctcccgtgcag
gacctgaaagctgcagtggccgcagttcatggggcagtacatgagctcctggagtttgcc
cgcagtgcagtgagcagtgccactcacacttctgaccgcactttgcacgccaagcttagc
cggcagctacagaagatggaggatgtgtaccagacactggtggtccatggtcaggtcctt
gacagtggccggggaggtccaggattcactctggacgacctggaccgcctggtggcctgc
tcacgggctgtgcccgaggatgccaagcagctggcctcctttttgcatggtaatgcctcg
ctgcttttcagacggaccaaagcccctggccccgggcctgagggcagcagctccctgcac
ctcaaccccaccgataaagccagcagcatccagtcacgccctctaccctcacctccaaag
ttcacctcccaggactctccggatggccagtatgagaacagtgaagggggttggatggag
gactatgactacgttcatctgcaggggaaggaggaatttgagaagacccagaaggaactg
ctggaaaagggcaacatcgtgcgacagggaaaaggccaactggagctgcagcagctgaaa
cagtttgagcgactggagcaggaggtgtctcgtcccatagaccatgacctggccaactgg
acaccagcccagccccttgtgccggggcggacagggggactggggccttcagaccgacag
ctgctgctcttctacttggagcagtgtgaggccaacctgaccacactgacagatgcggtg
gacgccttcttcaccgcagtggccaccaaccagccacccaagatctttgtggcacacagc
aagtttgtcattcttagtgcacacaagcttgtgttcattggggacacactgtcacggcag
gcaaaggcagctgatgtgcgaagcaaagtgacccactacagcaatctgctgtgtgacctc
ctgcgtggcatcgtggccaccaccaaggccgctgccctgcagtacccatccccatctgct
gcccaggacatggtagacagggtcaaggagctaggccacagcactcagcagttccgccgt
gtcctgggccagctggctgccgcctga

DBGET integrated database retrieval system