KEGG   Rattus norvegicus (rat): 25418
Entry
25418             CDS       T01003                                 

Gene name
Dpysl3, Crmp4, TUC-4b
Definition
(RefSeq) dihydropyrimidinase-like 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 DUF3928 Amidohydro_2
Other DBs
NCBI-GeneID: 25418
NCBI-ProteinID: NP_037066
RGD: 2410
Ensembl: ENSRNOG00000018992
UniProt: Q62952
Position
18p11-q11
AA seq 570 aa
MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEA
NGKMVMPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAY
EKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLSKEKGVNSFMVYMAYKDLYQVSNTE
LYEIFTCLGELGAIAQVHAENGDIIAQEQARMLEMGITGPEGHVLSRPEELEAEAVFRAI
TVASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAA
FVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEE
RMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDAVKIV
SAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYK
RIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSTRGSPTRPNPPVRNLHQSGFSL
SGTQVDEGVRSASKRIVAPPGGRSNITSLS
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgtcctaccagggcaagaagaacattcctcggatcacgagtgaccgtcttctaatcaag
ggagggagaatcgtcaacgatgatcagtccttttatgctgatatttacatggaggatggc
ttgataaagcaaattggagacaatctgattgtccctggaggtgtgaagaccattgaggcc
aatgggaagatggtgatgcctggaggcattgatgtccatacccacttccagatgccttac
aaggggatgaccacagtggacgatttcttccaagggacaaaggctgccttagcgggagga
accaccatgatcattgaccatgtggtacctgaacctgagtctagcctgaccgaggcctat
gaaaagtggcgtgagtgggctgacgggaagagctgctgtgactatgctttgcatgtggac
atcacccactggaatgacagcgtcaagcaagaggtgcagaacctcagtaaggaaaaaggc
gttaactccttcatggtttacatggcatacaaggatttatatcaagtgtccaacacagag
ctctatgagatcttcacctgcctgggagaactgggggccattgctcaagttcatgccgag
aatggagacatcattgcccaggagcaggcacgaatgctggaaatgggaataacaggccca
gaaggtcatgttctgagcagaccggaagagctggaagctgaggctgtgttccgtgccatc
accgtcgccagccagaccaactgccccctttatgtcaccaaggtcatgagcaagagcgcg
gctgatctcatctcacaagccaggaagaaaggaaatgtggtctttggcgagcccatcact
gccagcctgggaatagatggaacccattactggagtaagaactgggccaaggcagctgca
tttgtgacatccccacctctgagccctgacccaaccacacctgactacatcaactccttg
ctggccagtggagatctgcagctctctggaagtgcccactgtaccttcagcactgcccag
aaagccattgggaaggacaacttcacggctatccctgagggcaccaatggcgtggaggag
cgtatgtctgtcatctgggacaaggctgtggccacagggaagatggatgaaaaccagttt
gtggctgtgacaagtaccaacgctgccaagatattcaacctgtaccctcgcaaggggaga
atagctgtgggttctgacagcgaccttgtcatctgggatccagatgccgtgaagatcgtc
tctgccaagaaccaccagtcggttgcggaatacaacatctttgaagggatggagctgcgt
ggggcacctctggtggttatctgccagggcaagatcatgctggaagatggtaacctgcac
gtgacccagggggccggccgcttcattccctgcagcccattctctgactatgtctataag
cgcattaaagcaaggaggaagatggcggacctgcatgcagtcccaagaggcatgtatgat
ggaccagtgtttgacttgaccaccacccccaaggggggcaccccagctggctctactcga
ggctctcccactcggccaaacccaccagtgaggaacctccatcagtcgggatttagtctg
tcaggcacccaagtggatgagggtgtccgctcagccagcaaacgcattgtggcgccccct
ggaggccgttctaacatcacatccctgagttaa

DBGET integrated database retrieval system