KEGG   Rattus norvegicus (rat): 25470
Entry
25470             CDS       T01003                                 

Gene name
Kcna5, Kv1, Kv1.5
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 5
  KO
K04878  potassium voltage-gated channel Shaker-related subfamily A member 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25470 (Kcna5)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   25470 (Kcna5)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Other DBs
NCBI-GeneID: 25470
NCBI-ProteinID: NP_037104
RGD: 2953
Ensembl: ENSRNOG00000019719
UniProt: P19024
Position
4q42
AA seq 602 aa
MEISLVPLENGSAMTLRGGGEAGASCVQTPRGECGCPPTSGLNNQSKETLLRGRTTLEDA
NQGGRPLPPMAQELPQPRRLSAEDEEGEGDPGLGTVEEDQAPQDAGSLHHQRVLINISGL
RFETQLGTLAQFPNTLLGDPAKRLHYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPV
NVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSA
RAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGINGSVSGALSSG
PTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDVVAIFPYF
ITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM
RELGLLIFFLFIGVILFSSAVYFAEADNHGSHFSSIPDAFWWAVVTMTTVGYGDMRPITV
GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGNQRRESGLDTG
GQRKVSCSKASFCKTGGSLESSDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRET
DL
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggagatctccctggtgcccctggagaatggcagtgccatgaccctcagaggaggaggg
gaggcaggggcaagctgtgtgcagacccccaggggagagtgtgggtgccctccgacgtct
ggactcaataatcagtccaaagaaacactgttgagggggcgcacaacgctcgaggatgcg
aaccagggtggacggcctttgccccctatggctcaggagctgccacaacctagaaggcta
tctgctgaggatgaggagggagaaggcgaccctggcctgggcacagtggaggaggaccag
gctcctcaggatgcagggtcactccatcaccagcgagtcctcataaacatctccgggttg
cgtttcgagacgcagctgggcaccctggcacagtttcccaacaccctcctgggggaccca
gccaagcgcctgcactacttcgaccccttgagaaatgaatacttcttcgaccgcaaccgg
cccagcttcgatggcattttgtactactaccagtctgggggccgcctgcgcaggcccgtc
aatgtctccctggatgtgtttgcagatgagatccgcttttaccagctgggggacgaggcc
atggagcgcttccgggaggatgagggcttcatcaaggaagaggagaagcccctgccccgc
aacgagttccagcgccaggtatggcttatcttcgaatacccagaaagctctgggtccgca
agagccatcgccatagtgtcggtcctggtcattctcatctctatcatcaccttctgcctg
gagactctgcctgagttcagggatgagcgggagctgctacgccatcccccagtgccgccc
cagcccccagcccctgcccctgggatcaatggcagcgtctctggagcactttcctctggc
cctacggtggctccactcttgcctaggacactggccgatccattcttcatcgtggagacc
acatgtgtgatctggttcacttttgagttgctcgtgcgcttctttgcctgccccagcaag
gcagaattctctcggaatatcatgaacatcatcgatgtcgtggccatcttcccctacttt
atcaccctgggcaccgagctggcagagcaacaaccagggggagggggtcagaatgggcag
caggccatgtccctagccatcctcagggtgatccgcctggtgcgggtgtttcggatcttc
aagctctcccgccactccaagggactgcagatcctgggtaagaccttgcaagcatccatg
cgggaactcgggctactcatcttcttcctcttcattggagtcatcctcttctccagcgct
gtctacttcgcagaggcagacaatcacgggtcccatttctctagtatcccagatgccttc
tggtgggcagtagtcactatgaccactgtaggctatggagacatgagacccatcactgta
gggggcaagatcgtgggttcactgtgcgccatagctggggtcctcaccattgccctgcct
gtccccgtcatcgtctccaactttaattacttctatcatcgggagacagaccacgaggag
caggctgccctgaaggaagaacaaggcaaccagaggcgggagtctgggctggacacaggg
ggtcaacggaaggtcagctgcagcaaggcctccttttgcaagactgggggttccctggag
agttctgacagtatcagaaggggtagctgtcctctagaaaagtgtcacctcaaggccaag
agcaacgtggacttgcggaggtccctgtatgccctctgtctggacactagccgtgaaaca
gatttgtaa

DBGET integrated database retrieval system