KEGG   Rattus norvegicus (rat): 25477
Entry
25477             CDS       T01003                                 

Gene name
Lhcgr
Definition
(RefSeq) lutropin-choriogonadotropic hormone receptor precursor
  KO
K04248  lutropin-choriogonadotropic hormone receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04913  Ovarian steroidogenesis
rno04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25477 (Lhcgr)
   04024 cAMP signaling pathway
    25477 (Lhcgr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25477 (Lhcgr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25477 (Lhcgr)
   04917 Prolactin signaling pathway
    25477 (Lhcgr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25477 (Lhcgr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Lutropin-choriogonadotropic hormone
    25477 (Lhcgr)
SSDB
Motif
Pfam: 7tm_1 LRR_8 LRR_5 Comm
Other DBs
NCBI-GeneID: 25477
NCBI-ProteinID: NP_037110
RGD: 3007
Ensembl: ENSRNOG00000016712
UniProt: P16235
Position
6
AA seq 700 aa
MGRRVPALRQLLVLAVLLLKPSQLQSRELSGSRCPEPCDCAPDGALRCPGPRAGLARLSL
TYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEP
GAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNES
VTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQA
LPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSI
FENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDI
MGYAFLRVLIWLINILAIFGNLTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIA
SVDSQTKGQYYNHAIDWQTGSGCGAAGFFTVFASELSVYTLTVITLERWHTITYAVQLDQ
KLRLRHAIPIMLGGWLFSTLIATMPLVGISNYMKVSICLPMDVESTLSQVYILSILILNV
VAFVVICACYIRIYFAVQNPELTAPNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKV
PLITVTNSKILLVLFYPVNSCANPFLYAIFTKAFQRDFLLLLSRFGCCKRRAELYRRKEF
SAYTSNCKNGFPGASKPSQATLKLSTVHCQQPIPPRALTH
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggggcggcgagtcccagctctgagacagctgctggtgctggcagtgctgctgctgaag
ccttcacagctgcagtcccgagagctgtcagggtcgcgctgccccgagccctgcgactgc
gcaccggatggcgccctgcgctgtcctggccctcgagccggcctcgccagactatctctc
acctatctccctgtcaaagtaattccatcacaagctttcaggggacttaatgaggtcgta
aaaattgaaatctctcagagtgattccctggaaaggatagaagctaatgcctttgacaac
ctcctcaatttgtctgaactactgatccagaacaccaaaaacctgctatacattgaacct
ggtgcttttacaaacctccctcggttaaaatacctgagcatctgtaacacaggcatccga
acccttccagatgttacgaagatctcctcctctgaatttaatttcattctggaaatctgt
gataacttacacataaccaccatacccgggaatgctttccaagggatgaataacgagtct
gtcacactaaaactgtatggaaatggatttgaagaagtacaaagccatgcattcaatggg
acgactctaatctcgctggagctaaaagaaaacatctacctggagaagatgcacagtgga
gccttccagggggccacggggcccagcatcctggatatttcttccaccaaattgcaggcc
ctgccgagccacgggctggagtccattcagacgctcatcgccctgtcttcctactcactg
aaaacactgccctccaaagaaaaattcacgagcctcctggtcgccacgctgacctacccc
agccactgctgcgccttcaggaatttgccgaagaaagaacagaatttttcattttccatt
tttgaaaacttctccaaacaatgcgaaagcacagttagaaaagcagataacgagacgctt
tattccgccatctttgaggagaatgaactcagtggctgggattatgattatggcttctgt
tcacccaagacactccaatgtgctccagaaccagatgctttcaacccctgtgaagatatt
atgggctatgccttccttagggtcctgatttggctgattaatatactagccatctttggc
aacctgacagtcctctttgttctcctgaccagtcgttataaactgacagtgccccgcttc
ctcatgtgtaatctctcctttgcagacttttgcatggggctctacctgctgctcattgcc
tccgtggactcccaaacaaaaggccagtactataaccacgccatagactggcagacaggg
agtggctgcggtgcagctggcttctttactgtgtttgccagtgaactctctgtctacacc
ctgacggttatcaccctggaaaggtggcacaccatcacctatgctgtacagctagaccaa
aagctaagactgaggcatgccatcccaattatgctcggaggatggctcttttctacgctg
atcgccacgatgccccttgtgggtatcagcaattacatgaaggtcagcatctgcctcccc
atggatgtggaatccactctgtcccaagtctacatattatccatcttaatcctcaacgtg
gtggccttcgtcgtcatctgtgcttgctacattaggatctactttgcagttcaaaatcca
gagctgacagctcctaacaaggacacaaaaattgctaagaagatggccatcctcatcttc
acagacttcacgtgcatggcgcccatctctttctttgccatctcggctgccttcaaagtg
ccccttatcactgtcaccaactcgaaaatcttactggtccttttttatcctgtcaattct
tgtgccaatccatttctgtatgcgatcttcacgaaggcgtttcagagagatttccttctg
ctgctgagccgattcggctgctgtaaacgccgggcggagctttacagaaggaaggaattt
tctgcatatacttccaactgcaaaaatggcttcccaggagcaagtaagccgtcccaggct
accctgaagttgtccacagtgcactgtcaacagcccataccaccgagagcgttaactcac
tag

DBGET integrated database retrieval system