KEGG   Rattus norvegicus (rat): 25493
Entry
25493             CDS       T01003                                 

Gene name
Nfkbia
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04931  Insulin resistance
rno05132  Salmonella infection
rno05134  Legionellosis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    25493 (Nfkbia)
   04668 TNF signaling pathway
    25493 (Nfkbia)
   04024 cAMP signaling pathway
    25493 (Nfkbia)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    25493 (Nfkbia)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25493 (Nfkbia)
   04621 NOD-like receptor signaling pathway
    25493 (Nfkbia)
   04622 RIG-I-like receptor signaling pathway
    25493 (Nfkbia)
   04623 Cytosolic DNA-sensing pathway
    25493 (Nfkbia)
   04625 C-type lectin receptor signaling pathway
    25493 (Nfkbia)
   04660 T cell receptor signaling pathway
    25493 (Nfkbia)
   04658 Th1 and Th2 cell differentiation
    25493 (Nfkbia)
   04659 Th17 cell differentiation
    25493 (Nfkbia)
   04657 IL-17 signaling pathway
    25493 (Nfkbia)
   04662 B cell receptor signaling pathway
    25493 (Nfkbia)
   04062 Chemokine signaling pathway
    25493 (Nfkbia)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    25493 (Nfkbia)
   04926 Relaxin signaling pathway
    25493 (Nfkbia)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25493 (Nfkbia)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25493 (Nfkbia)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25493 (Nfkbia)
   05203 Viral carcinogenesis
    25493 (Nfkbia)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25493 (Nfkbia)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    25493 (Nfkbia)
   05215 Prostate cancer
    25493 (Nfkbia)
   05222 Small cell lung cancer
    25493 (Nfkbia)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25493 (Nfkbia)
   05170 Human immunodeficiency virus 1 infection
    25493 (Nfkbia)
   05161 Hepatitis B
    25493 (Nfkbia)
   05160 Hepatitis C
    25493 (Nfkbia)
   05171 Coronavirus disease - COVID-19
    25493 (Nfkbia)
   05164 Influenza A
    25493 (Nfkbia)
   05162 Measles
    25493 (Nfkbia)
   05168 Herpes simplex virus 1 infection
    25493 (Nfkbia)
   05163 Human cytomegalovirus infection
    25493 (Nfkbia)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25493 (Nfkbia)
   05169 Epstein-Barr virus infection
    25493 (Nfkbia)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    25493 (Nfkbia)
   05135 Yersinia infection
    25493 (Nfkbia)
   05134 Legionellosis
    25493 (Nfkbia)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25493 (Nfkbia)
   05140 Leishmaniasis
    25493 (Nfkbia)
   05142 Chagas disease
    25493 (Nfkbia)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25493 (Nfkbia)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25493 (Nfkbia)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25493 (Nfkbia)
   04131 Membrane trafficking [BR:rno04131]
    25493 (Nfkbia)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    25493 (Nfkbia)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    25493 (Nfkbia)
SSDB
Motif
Pfam: Ank Ank_2 Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 25493
NCBI-ProteinID: NP_001099190
RGD: 3171
Ensembl: ENSRNOG00000007390
UniProt: Q63746
Position
6
AA seq 314 aa
MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEDYEQMVKELREIRLQPQEAP
LAAEPWKQQLTEDGDSFLHLAIIHEEKTLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATN
YNGHTCLHLASIHGYLGIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagccagctgggcacggccaggactgggccatggagggcccgcgggacggcctc
aagaaggagcggttggtggacgaccgccacgacagcggcttggactccatgaaggacgag
gattacgagcagatggtgaaggagctgcgggagatccgcctgcagccgcaggaggcgcct
ctggctgccgagccctggaagcaacagctcacggaggacggagactcgttcctgcacttg
gcaatcatccatgaagagaagacactgaccatggaagtgattggtcaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccaggaattgctgaggcacttctgaaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctccatcttgcctgtgagcagggctgcctggccagtgta
gcagtcttgactcagacctgtacgccccagcatctccactccgtcctgcaggccaccaac
tacaacggccacacgtgtctacacttagcctctatccatggctacctgggcatcgtggag
cacttggtgactttgggtgctgatgtcaacgctcaggagccctgtaatggccggacagcc
ctccaccttgcagtggacctgcagaatcctgacctggtctcgctcctgttgaagtgtggg
gctgatgtcaacagagtaacctaccagggctactccccctaccagcttacgtggggccgc
ccaagtacccggatacagcagcagctgggccagctgaccctggaaaatcttcagacgctg
cccgagagtgaggatgaggagagctatgacacggagtcagaattcacggaagatgagttg
ccctacgatgactgtgtgtttggaggccagcgtctgacgttataa

DBGET integrated database retrieval system