KEGG   Rattus norvegicus (rat): 25515
Entry
25515             CDS       T01003                                 

Gene name
Plk1
Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    25515 (Plk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25515 (Plk1)
   04114 Oocyte meiosis
    25515 (Plk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    25515 (Plk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25515 (Plk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    25515 (Plk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     25515 (Plk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   25515 (Plk1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     25515 (Plk1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    25515 (Plk1)
  Sister chromatid separation proteins
   Polo kinases
    25515 (Plk1)
SSDB
Motif
Pfam: Pkinase POLO_box PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH ABC1
Other DBs
NCBI-GeneID: 25515
NCBI-ProteinID: NP_058796
RGD: 3352
Ensembl: ENSRNOG00000018815
UniProt: Q62673
Position
1
AA seq 603 aa
MNAAAKAGKLARAPADLGKGGVPGDAAPGAPGAAPLAKEIPEVLMDPRSRRQYVRGRFLG
KGGFAKCFEISDSDTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHGFF
EDSDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGVENPLPDRPREKEE
PVVRETNEAIECHLSDLLQQLTSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLN
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGTVQINFFQDHTK
LILCPLMAAVTYINEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSACNRL
KAS
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgaatgcagcggccaaagctggaaagctggctcgagcaccagccgacctagggaaaggt
ggggtcccgggagacgcagctcccggtgccccaggggccgccccgctggcgaaagagatt
ccggaggtcctgatggatccacgcagccggcggcagtatgtacggggccgctttctgggt
aaaggaggcttcgccaaatgcttcgaaatctcagactcagacacaaaagaggtgttcgca
ggcaagatcgtgcctaagtctttgctgctcaagccccatcagaaggagaaaatgtctatg
gagatctccattcaccgcagcctcgcacaccagcacgtcgtaggcttccatggctttttt
gaggacagcgactttgtgttcgtggttttggagctctgtcgcaggaggtctctcctggag
ctgcacaaaaggaggaaggcgctgaccgagcccgaggcccgatactacctgcggcagata
gtcctgggttgccagtacctgcaccgcaatcaagtcattcacagggacctcaaactgggc
aacctctttctgaatgaggatctggaggtgaaaataggggattttggcctggcaacaaaa
gtggaatatgaaggggaacggaagaagaccctgtgtggcactcctaactacatagctccc
gaggtgctgagcaagaagggacacagctttgaggtggacgtgtggtccattgggtgcatc
atgtataccttgctggtgggcaagccaccttttgagacctcatgcctaaaagagacctac
ctccggatcaagaaaaatgaatacagtattcccaagcacatcaacccagtggctgcctcc
ctcatccagaaaatgcttcagacagaccccactgcccgccccaccattcacgagttgctc
aatgacgagttcttcacttccggctacatccccgcccgtctgcctattacctgcctcacc
atcccaccaaggttttcaatagctcccagcagcctagaccccagcaacaggaagcctctc
acagtccttaataaaggtgtggagaaccccctgcctgaccgtccccgagagaaagaggaa
ccagtggttcgggagacaaatgaggccatcgagtgccaccttagtgacttgctacagcag
ctgaccagtgtcaacgcctccaagccctcagagcgagggctggtgcggcaagaggaggcc
gaggatcctgcttgcatccctatcttctgggtcagcaaatgggtagactattcggacaag
tatggccttggttatcagctatgtgacaacagtgtgggagtgctctttaatgactcaaca
cgcctcatcctctacaatgacggggacagcctgcagtacatagagcgtgatggcacggag
tcctacctcactgtgagctcccaccccaactccttgatgaagaagatcactctcctcaac
tatttccgcaattacatgagtgaacacctgttgaaggcaggggccaacatcacgccccgg
gaaggcgacgagctggcccggctgccctacctacgaacatggttccgcacacgcagcgcc
atcatcctgcacctcagcaatggcacagtacagattaatttcttccaggaccacaccaaa
cttatcctgtgccccctgatggcagcagtgacctacatcaacgagaagagggacttccgg
acataccgcctgagccttctggaggaatatggctgctgcaaggaactggctagccgcctc
cgctatgcccgcaccatggtagacaagctgctgagctcgcgttccgcctgcaaccgcctc
aaggcctcctag

DBGET integrated database retrieval system