KEGG   Rattus norvegicus (rat): 25544
Entry
25544             CDS       T01003                                 

Gene name
Sele
Definition
(RefSeq) E-selectin precursor
  KO
K06494  selectin, endothelial cell
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04668  TNF signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05143  African trypanosomiasis
rno05144  Malaria
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    25544 (Sele)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    25544 (Sele)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    25544 (Sele)
   05143 African trypanosomiasis
    25544 (Sele)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25544 (Sele)
   05418 Fluid shear stress and atherosclerosis
    25544 (Sele)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25544 (Sele)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    25544 (Sele)
   04090 CD molecules [BR:rno04090]
    25544 (Sele)
   04091 Lectins [BR:rno04091]
    25544 (Sele)
Cell adhesion molecules [BR:rno04515]
 Selectins
  Selectin family
   25544 (Sele)
CD molecules [BR:rno04090]
 Proteins
  25544 (Sele)
Lectins [BR:rno04091]
 C-Type lectins
  Group 4: Selectins
   25544 (Sele)
SSDB
Motif
Pfam: Sushi Lectin_C EGF hEGF EGF_2 EGF_3
Other DBs
NCBI-GeneID: 25544
NCBI-ProteinID: NP_620234
RGD: 3654
Ensembl: ENSRNOG00000002723
Vega: OTTRNOG00000001146
UniProt: P98105
Position
13
AA seq 549 aa
MNASCFLSALTFVLLIGKSIAWYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLN
STLRYSPSYYWIGIRKVNNVWIWVGTQKPLTEEAKNWAPGEPNNKQRNEDCVEIYIQRPK
DSGMWNDERCDKKKLALCYTASCTNTSCSGHGECVETINSYTCKCHPGFLGPKCDQVVTC
QEQEYPDHGSLNCTHPFGLFSYNSSCSFSCERGYVPSSMETTVRCTSSGEWSAPAPACHV
VECKALTQPAHGVRKCSSNPGSYPWNTTCTFDCEEGYRRVGAQNLQCTSSGVWDNEKPSC
KAVTCDAIPRPQNGSVSCSNSTAGALAFKSSCNFTCEHSFTLQGPAQVECSAQGQWTPQI
PVCKASQCEALSAPQRGHMKCLPSASAPFQSGSSCKFSCDEGFELKGSRRLQCGPRGEWD
SEKPTCAGVQCSSLDLPGKMNMSCSGPAVFGTVCEFTCPEGWTLNGSSILTCGATGRWSA
MLPTCEAPANPPRPLVVALSVAATSLLTLSSLIYVLKRFFWKKAKKFVPASSCQSLQSFE
NYQGPSYII
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgaatgcctcgtgctttctctctgctctcacctttgttctcctcattggaaagagcata
gcttggtactacaatgcctccagtgagctcatgacatatgatgaagcaagtgcgtattgt
caacgggactacacacatctggtggcgattcagaacaaggaagagatcaattacctaaac
tccactctgaggtattcaccaagttattactggattggaatcagaaaagtcaataatgta
tggatctgggtggggacccagaagcctctgacggaggaagctaagaactgggcgccaggt
gaaccaaacaacaaacaaagaaacgaggactgtgtagagatctacatccaaagacccaaa
gactccggcatgtggaatgacgagagatgtgacaaaaagaaactggctctgtgttacaca
gcttcctgtaccaacacatcctgcagtggtcacggtgaatgcgttgagaccatcaatagt
tatacctgcaaatgtcaccccggcttcctgggacccaagtgtgaccaagttgtgacctgc
caagaacaggaataccctgaccatggaagcctgaactgcacccacccattcggcctcttc
agctataattcatcctgctccttcagctgtgaaaggggctatgtgcccagcagcatggag
accacagtgcggtgtacgtcctctggagagtggagtgcacctgctcctgcctgccatgtg
gttgaatgtaaagctttgacccaacctgcccacggagtcaggaaatgttcctcaaatcct
gggagctacccatggaatacaacgtgcacgtttgattgtgaggaagggtacaggagagtt
ggagctcagaatctacagtgtacctcatccggtgtctgggacaacgagaagccatcgtgc
aaagctgtgacctgtgatgccatccctcggcctcagaatggctctgtgagctgcagcaac
tcaacggctggagcgcttgcctttaagtcttcctgtaattttacctgtgagcacagtttc
acattgcagggcccagcccaggttgaatgcagtgcacaagggcagtggacaccacaaatc
ccagtgtgcaaagcttcccagtgtgaagccttatctgcaccacagcgaggccacatgaaa
tgtcttcccagtgcctctgcacccttccaaagtgggtccagttgtaagttctcctgtgac
gaaggatttgaattgaagggatcaagaaggcttcagtgtggtccaagaggggagtgggac
agcgaaaagcccacatgtgcaggggtacagtgttcaagccttgaccttccaggaaagatg
aacatgagttgcagtgggccagcagtttttggcacggtatgtgaatttacatgtcctgag
ggttggacactcaacggatcttcaatcctgacatgtggtgccacaggacgctggtctgcg
atgctgcctacttgtgaagccccagccaaccctccccgtcccttggtagtggcactctct
gtggcagcaacctcacttctgacattgtcctcattgatctacgtgttgaagagattcttt
tggaagaaagcaaagaaattcgttcctgctagtagctgccaaagtcttcaatcgtttgaa
aactatcaagggccttcttacatcatctaa

DBGET integrated database retrieval system