KEGG   Rattus norvegicus (rat): 25554
Entry
25554             CDS       T01003                                 

Gene name
Snai2, Slug
Definition
(RefSeq) snail family transcriptional repressor 2
  KO
K05706  snail 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    25554 (Snai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    25554 (Snai2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25554 (Snai2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    25554 (Snai2)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-met zf-Di19 zf-C2HE zf-BED Elf1 zinc_ribbon_15 Zn-ribbon_8 zf-H2C2_5 Zn_Tnp_IS1595 DUF4764 Ogr_Delta
Other DBs
NCBI-GeneID: 25554
NCBI-ProteinID: NP_037167
RGD: 3722
Ensembl: ENSRNOG00000047699
UniProt: O08954
Position
11q23
AA seq 268 aa
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLCESYPMPVIPKPEILTSGAYSPITVWT
SAVPFHSPLPSGLSPLTGYSSSLGRVSPLPSSDTSSKDHSGSESPISDEEERLQPKLSDP
HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQARKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH
NT seq 807 nt   +upstreamnt  +downstreamnt
atgccgcgctccttcctcgtcaagaaacatttcaacgcctccaagaagcccaactacagc
gaactggacacacacacagtgatcatttctccatacctctgtgagagctaccccatgcct
gtcataccaaaaccagagatcctcacctcaggagcgtacagccctataactgtatggaca
tcagcagttccattccactcccctctgcccagcggcctttctcctcttactggatactcc
tcatctttggggcgtgtaagccccctgccttcatctgacacttcatccaaggatcacagt
ggttcagaaagtcccattagtgacgaagaggagagactccagcccaagctttcagacccc
catgccattgaagctgagaagtttcagtgcaatttatgcaataagacctattctactttc
tctggtctggccaaacataagcagctgcactgtgatgcccaggctaggaaatcgttcagc
tgcaaatactgtgacaaggaatatgtgagcctgggtgccctgaagatgcacattcggacc
cacacgttgccttgtgtctgcaagatctgtggcaaggctttctccagaccctggctgctt
caaggacacattagaacacacactggggaaaagcctttctcttgccctcactgcaataga
gcttttgcagacagatcaaacctgagggcacatctgcagacccactctgatgtaaagaaa
taccagtgcaaaaactgctccaaaaccttctccagaatgtcgcttctgcataaacatgag
gagtctggctgctgtgtggcacactga

DBGET integrated database retrieval system